Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A093YY60

Protein Details
Accession A0A093YY60    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
55-101KDMAEEKKRQKKLKKIKEKEAKEEKKKMEKEKKKMEKEKKKMEEETABasic
NLS Segment(s)
PositionSequence
60-97EKKRQKKLKKIKEKEAKEEKKKMEKEKKKMEKEKKKME
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MASQPPTTGSVSAKISARNLEMTFEKNEIIHKQNLANCRLGCLQAERAYKKELDKDMAEEKKRQKKLKKIKEKEAKEEKKKMEKEKKKMEKEKKKMEEETAREMGKKGDYKQRSIFCWAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.26
4 0.26
5 0.25
6 0.23
7 0.23
8 0.23
9 0.24
10 0.24
11 0.22
12 0.21
13 0.17
14 0.2
15 0.22
16 0.24
17 0.24
18 0.23
19 0.26
20 0.3
21 0.35
22 0.34
23 0.35
24 0.3
25 0.31
26 0.3
27 0.26
28 0.24
29 0.21
30 0.22
31 0.23
32 0.29
33 0.27
34 0.28
35 0.29
36 0.3
37 0.3
38 0.31
39 0.27
40 0.25
41 0.24
42 0.26
43 0.31
44 0.35
45 0.35
46 0.35
47 0.41
48 0.47
49 0.54
50 0.58
51 0.59
52 0.64
53 0.73
54 0.78
55 0.81
56 0.8
57 0.84
58 0.87
59 0.84
60 0.84
61 0.84
62 0.83
63 0.81
64 0.81
65 0.77
66 0.77
67 0.78
68 0.79
69 0.79
70 0.79
71 0.8
72 0.83
73 0.86
74 0.87
75 0.91
76 0.91
77 0.91
78 0.91
79 0.92
80 0.9
81 0.87
82 0.81
83 0.79
84 0.78
85 0.72
86 0.69
87 0.64
88 0.55
89 0.49
90 0.45
91 0.39
92 0.36
93 0.36
94 0.34
95 0.39
96 0.42
97 0.48
98 0.56
99 0.59
100 0.56