Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094B061

Protein Details
Accession A0A094B061   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKIPWRLSKFQKARQRKRLRAVDTVHydrophilic
76-105DKYTIFDRKEKKYRKAIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
84-95KEKKYRKAIHKL
Subcellular Location(s) mito 26.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTNSLSVGLLWKIPWRLSKFQKARQRKRLRAVDTVVSVVDQALAKAGMEIKPVQRWKAEMPIEQEMVPRDKYTIFDRKEKKYRKAIHKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.14
4 0.17
5 0.18
6 0.2
7 0.25
8 0.29
9 0.37
10 0.44
11 0.54
12 0.59
13 0.66
14 0.74
15 0.78
16 0.83
17 0.85
18 0.89
19 0.87
20 0.88
21 0.88
22 0.83
23 0.79
24 0.72
25 0.64
26 0.54
27 0.46
28 0.36
29 0.26
30 0.2
31 0.13
32 0.11
33 0.06
34 0.05
35 0.04
36 0.04
37 0.04
38 0.05
39 0.06
40 0.05
41 0.06
42 0.08
43 0.09
44 0.14
45 0.16
46 0.17
47 0.17
48 0.18
49 0.19
50 0.26
51 0.28
52 0.26
53 0.29
54 0.31
55 0.31
56 0.29
57 0.29
58 0.22
59 0.22
60 0.2
61 0.16
62 0.13
63 0.13
64 0.15
65 0.21
66 0.28
67 0.29
68 0.37
69 0.44
70 0.53
71 0.63
72 0.69
73 0.71
74 0.72
75 0.79
76 0.81
77 0.85
78 0.85
79 0.86
80 0.86
81 0.89
82 0.88
83 0.88
84 0.83
85 0.8
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79