Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A093YUJ8

Protein Details
Accession A0A093YUJ8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-41MTRRRNGNPPKRRRSKTLLLRRERTRKRRERTKNKTAHQEABasic
NLS Segment(s)
PositionSequence
3-35RRRNGNPPKRRRSKTLLLRRERTRKRRERTKNK
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MTRRRNGNPPKRRRSKTLLLRRERTRKRRERTKNKTAHQEATNKNTAIIEEVTEGLSHALDQRIVEEYNKREIQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.83
4 0.83
5 0.83
6 0.81
7 0.84
8 0.85
9 0.87
10 0.86
11 0.86
12 0.86
13 0.85
14 0.86
15 0.89
16 0.91
17 0.91
18 0.91
19 0.91
20 0.9
21 0.85
22 0.86
23 0.79
24 0.73
25 0.66
26 0.65
27 0.58
28 0.54
29 0.53
30 0.42
31 0.38
32 0.32
33 0.27
34 0.21
35 0.17
36 0.12
37 0.08
38 0.09
39 0.09
40 0.08
41 0.09
42 0.06
43 0.06
44 0.06
45 0.07
46 0.07
47 0.08
48 0.08
49 0.09
50 0.12
51 0.13
52 0.16
53 0.21
54 0.23
55 0.31