Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JSE1

Protein Details
Accession C4JSE1   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
75-94NSRHHSMSYHPSRRKPRPYLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 11.5, cyto 7.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003010  C-N_Hydrolase  
IPR036526  C-N_Hydrolase_sf  
IPR045254  Nit1/2_C-N_Hydrolase  
IPR001110  UPF0012_CS  
Gene Ontology GO:0016811  F:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides  
GO:0006807  P:nitrogen compound metabolic process  
KEGG ure:UREG_05380  -  
Pfam View protein in Pfam  
PF00795  CN_hydrolase  
PROSITE View protein in PROSITE  
PS50263  CN_HYDROLASE  
PS01227  UPF0012  
CDD cd07572  nit  
Amino Acid Sequences MSAILKKPLKLALVQLATGADKPVNLARARSKVLEAAKAGASLIVLPECFNSPYGTQYFPHYAETLLPLPSHNWNSRHHSMSYHPSRRKPRPYLVGGSIPEYVPETKQYFNTSLVFSPTGSLIATHRKTHLFDIDIPGKIRFKESEVLSAGNKLTIVDLPEYGKIGLAICYDIRFPESAMIAARNGCFLLVYPGAFNTTTGPLHWSLLGRARAVDNEVYTALCSPARDMNASYHAWGHSLVANPRGEILVEGAESEDVLYADLDQGAIDEMRKSIPVYDQRRFDVYPDISKGDVKFEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.27
4 0.25
5 0.24
6 0.2
7 0.11
8 0.09
9 0.12
10 0.14
11 0.19
12 0.19
13 0.23
14 0.29
15 0.34
16 0.38
17 0.37
18 0.36
19 0.37
20 0.39
21 0.39
22 0.34
23 0.31
24 0.28
25 0.26
26 0.24
27 0.18
28 0.15
29 0.1
30 0.09
31 0.07
32 0.06
33 0.07
34 0.08
35 0.09
36 0.1
37 0.11
38 0.12
39 0.12
40 0.16
41 0.18
42 0.19
43 0.18
44 0.22
45 0.26
46 0.25
47 0.26
48 0.23
49 0.21
50 0.2
51 0.23
52 0.2
53 0.16
54 0.15
55 0.14
56 0.15
57 0.2
58 0.25
59 0.27
60 0.28
61 0.33
62 0.41
63 0.46
64 0.47
65 0.43
66 0.4
67 0.39
68 0.47
69 0.52
70 0.53
71 0.54
72 0.59
73 0.69
74 0.76
75 0.81
76 0.78
77 0.76
78 0.75
79 0.75
80 0.72
81 0.66
82 0.62
83 0.53
84 0.48
85 0.4
86 0.3
87 0.25
88 0.2
89 0.17
90 0.11
91 0.15
92 0.14
93 0.15
94 0.17
95 0.2
96 0.2
97 0.21
98 0.22
99 0.2
100 0.18
101 0.19
102 0.18
103 0.15
104 0.13
105 0.11
106 0.1
107 0.08
108 0.08
109 0.07
110 0.15
111 0.17
112 0.18
113 0.2
114 0.21
115 0.23
116 0.24
117 0.26
118 0.2
119 0.19
120 0.24
121 0.25
122 0.25
123 0.24
124 0.24
125 0.22
126 0.2
127 0.2
128 0.15
129 0.14
130 0.18
131 0.17
132 0.21
133 0.2
134 0.21
135 0.2
136 0.21
137 0.18
138 0.13
139 0.12
140 0.07
141 0.07
142 0.06
143 0.07
144 0.06
145 0.07
146 0.08
147 0.08
148 0.09
149 0.08
150 0.07
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.06
158 0.07
159 0.06
160 0.07
161 0.06
162 0.06
163 0.07
164 0.08
165 0.08
166 0.08
167 0.09
168 0.09
169 0.1
170 0.09
171 0.08
172 0.08
173 0.07
174 0.06
175 0.05
176 0.09
177 0.08
178 0.08
179 0.08
180 0.08
181 0.1
182 0.1
183 0.1
184 0.08
185 0.1
186 0.1
187 0.1
188 0.12
189 0.12
190 0.13
191 0.14
192 0.12
193 0.12
194 0.19
195 0.2
196 0.18
197 0.18
198 0.18
199 0.18
200 0.2
201 0.19
202 0.13
203 0.12
204 0.12
205 0.11
206 0.11
207 0.11
208 0.09
209 0.09
210 0.09
211 0.09
212 0.12
213 0.14
214 0.15
215 0.16
216 0.18
217 0.22
218 0.22
219 0.21
220 0.2
221 0.19
222 0.18
223 0.17
224 0.15
225 0.13
226 0.17
227 0.18
228 0.22
229 0.22
230 0.21
231 0.22
232 0.21
233 0.18
234 0.14
235 0.13
236 0.08
237 0.08
238 0.08
239 0.08
240 0.07
241 0.07
242 0.07
243 0.06
244 0.05
245 0.05
246 0.05
247 0.05
248 0.06
249 0.06
250 0.06
251 0.05
252 0.05
253 0.06
254 0.06
255 0.07
256 0.07
257 0.08
258 0.09
259 0.1
260 0.11
261 0.12
262 0.19
263 0.29
264 0.36
265 0.43
266 0.47
267 0.5
268 0.54
269 0.52
270 0.47
271 0.46
272 0.43
273 0.43
274 0.42
275 0.41
276 0.37
277 0.4
278 0.38