Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093YZ92

Protein Details
Accession A0A093YZ92   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
82-106SPSPPPTPKEKPLRTKRGRRAPDFLHydrophilic
NLS Segment(s)
PositionSequence
89-101PKEKPLRTKRGRR
Subcellular Location(s) nucl 15, cyto_nucl 12.5, cyto 8, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MVLPPANAAPPPTLPPSVEEAYRRKCIQLRHRMKTVEEANDASRIRLLRMRRGIEKMRLERAFLLEQLSKRTSTNVEDSDGSPSPPPTPKEKPLRTKRGRRAPDFLQDQPEAASGLSHGNGSRQASFAGSANGRSASNPSNAAAADQSRSSQANGTSAPKQPRSGFDVFVKSMRSVLLVANRQKIKEGTYDVDQDLARKWTNLGAKKQGDYCRRFEEGEYEGWEEVEKRDTQELVEGDDTDRDADVAGEAEDVEMGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.29
4 0.29
5 0.31
6 0.33
7 0.37
8 0.41
9 0.48
10 0.46
11 0.45
12 0.47
13 0.53
14 0.58
15 0.61
16 0.65
17 0.67
18 0.73
19 0.71
20 0.69
21 0.68
22 0.64
23 0.58
24 0.51
25 0.45
26 0.39
27 0.42
28 0.4
29 0.31
30 0.27
31 0.22
32 0.21
33 0.24
34 0.26
35 0.3
36 0.38
37 0.42
38 0.45
39 0.51
40 0.56
41 0.59
42 0.65
43 0.61
44 0.62
45 0.58
46 0.54
47 0.48
48 0.46
49 0.39
50 0.3
51 0.28
52 0.23
53 0.23
54 0.26
55 0.26
56 0.23
57 0.22
58 0.23
59 0.22
60 0.22
61 0.27
62 0.23
63 0.24
64 0.24
65 0.25
66 0.27
67 0.25
68 0.22
69 0.18
70 0.17
71 0.17
72 0.21
73 0.22
74 0.25
75 0.31
76 0.39
77 0.48
78 0.56
79 0.64
80 0.7
81 0.79
82 0.81
83 0.85
84 0.87
85 0.87
86 0.87
87 0.81
88 0.77
89 0.7
90 0.69
91 0.64
92 0.56
93 0.5
94 0.42
95 0.37
96 0.31
97 0.26
98 0.18
99 0.12
100 0.1
101 0.05
102 0.06
103 0.06
104 0.06
105 0.05
106 0.06
107 0.08
108 0.09
109 0.09
110 0.09
111 0.09
112 0.09
113 0.09
114 0.09
115 0.09
116 0.08
117 0.08
118 0.08
119 0.09
120 0.09
121 0.08
122 0.1
123 0.1
124 0.12
125 0.12
126 0.12
127 0.12
128 0.12
129 0.12
130 0.1
131 0.09
132 0.08
133 0.08
134 0.08
135 0.09
136 0.09
137 0.09
138 0.11
139 0.11
140 0.12
141 0.13
142 0.16
143 0.18
144 0.23
145 0.28
146 0.28
147 0.31
148 0.3
149 0.32
150 0.35
151 0.34
152 0.31
153 0.3
154 0.32
155 0.3
156 0.3
157 0.28
158 0.22
159 0.2
160 0.17
161 0.14
162 0.11
163 0.12
164 0.17
165 0.22
166 0.26
167 0.32
168 0.34
169 0.33
170 0.35
171 0.34
172 0.3
173 0.28
174 0.28
175 0.24
176 0.26
177 0.29
178 0.26
179 0.28
180 0.26
181 0.22
182 0.2
183 0.21
184 0.18
185 0.15
186 0.15
187 0.18
188 0.25
189 0.31
190 0.35
191 0.41
192 0.44
193 0.47
194 0.53
195 0.56
196 0.58
197 0.56
198 0.55
199 0.52
200 0.52
201 0.5
202 0.44
203 0.41
204 0.34
205 0.33
206 0.31
207 0.27
208 0.24
209 0.23
210 0.22
211 0.18
212 0.16
213 0.17
214 0.15
215 0.16
216 0.19
217 0.19
218 0.19
219 0.24
220 0.23
221 0.23
222 0.23
223 0.21
224 0.19
225 0.2
226 0.2
227 0.14
228 0.14
229 0.1
230 0.09
231 0.08
232 0.08
233 0.07
234 0.07
235 0.06
236 0.06
237 0.06