Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A093YP42

Protein Details
Accession A0A093YP42    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
413-432DSWQHDLRAFKKKREKYLLYHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR008302  NamZ  
Gene Ontology GO:0033922  F:peptidoglycan beta-N-acetylmuramidase activity  
Pfam View protein in Pfam  
PF07075  DUF1343  
Amino Acid Sequences MKATSVRVLEFLLVFPTLVFGGKVRTGLEELQTTNFTQLLGQKVIVLTNPTGVTSALDLGVDVMFESGVVDLVGVMGPEHGFRGTAQAGGSTGTFVDEQTGLTVYDAYNANTTELRSYITESGADTVVFDIQDVGARFYTYTWAMYDTMVASALSNVSFVVLDRPNPITGLNAFGPVLNESYASYVGRRAIAQAHGMTSGELAEMFVGEGWIRQAANGSNLSLQIIKMKGWERSMAWKETGLPWVMPSPNMPTPDSALIYPGACMVEGTSLSEGRGTTRPFELLGAPYTNDSWANTMRSLQIPYTAYRPACFSPTTSKFVSQTACGLQTYITLNGARDYYNFDPVHLGVSLLWSAKHLYTAENNDTGLGDSTQSFHWLPNGSLKSLYDVDVLAGGPLIRQGIEAGLTPDEIRDSWQHDLRAFKKKREKYLLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.11
4 0.09
5 0.09
6 0.09
7 0.07
8 0.11
9 0.13
10 0.14
11 0.14
12 0.16
13 0.18
14 0.2
15 0.23
16 0.22
17 0.22
18 0.24
19 0.25
20 0.23
21 0.22
22 0.2
23 0.17
24 0.15
25 0.18
26 0.2
27 0.2
28 0.19
29 0.2
30 0.2
31 0.21
32 0.2
33 0.19
34 0.14
35 0.16
36 0.16
37 0.15
38 0.15
39 0.14
40 0.14
41 0.12
42 0.12
43 0.09
44 0.08
45 0.08
46 0.08
47 0.07
48 0.06
49 0.05
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.03
58 0.03
59 0.04
60 0.04
61 0.03
62 0.03
63 0.04
64 0.04
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.11
71 0.11
72 0.12
73 0.12
74 0.12
75 0.12
76 0.12
77 0.12
78 0.08
79 0.07
80 0.07
81 0.07
82 0.06
83 0.08
84 0.07
85 0.07
86 0.08
87 0.09
88 0.08
89 0.08
90 0.09
91 0.07
92 0.1
93 0.11
94 0.11
95 0.12
96 0.12
97 0.13
98 0.14
99 0.14
100 0.12
101 0.11
102 0.12
103 0.11
104 0.14
105 0.14
106 0.14
107 0.14
108 0.13
109 0.14
110 0.13
111 0.12
112 0.09
113 0.08
114 0.08
115 0.07
116 0.07
117 0.05
118 0.05
119 0.08
120 0.08
121 0.09
122 0.09
123 0.09
124 0.09
125 0.09
126 0.12
127 0.09
128 0.1
129 0.09
130 0.1
131 0.11
132 0.11
133 0.11
134 0.09
135 0.09
136 0.08
137 0.08
138 0.06
139 0.05
140 0.06
141 0.05
142 0.05
143 0.04
144 0.04
145 0.04
146 0.04
147 0.09
148 0.09
149 0.1
150 0.12
151 0.14
152 0.14
153 0.14
154 0.14
155 0.11
156 0.11
157 0.14
158 0.12
159 0.11
160 0.11
161 0.11
162 0.11
163 0.1
164 0.1
165 0.07
166 0.07
167 0.06
168 0.07
169 0.08
170 0.07
171 0.07
172 0.08
173 0.09
174 0.09
175 0.09
176 0.09
177 0.11
178 0.12
179 0.13
180 0.12
181 0.12
182 0.11
183 0.11
184 0.1
185 0.08
186 0.07
187 0.05
188 0.04
189 0.03
190 0.03
191 0.03
192 0.03
193 0.02
194 0.02
195 0.02
196 0.03
197 0.03
198 0.04
199 0.04
200 0.04
201 0.05
202 0.05
203 0.08
204 0.08
205 0.09
206 0.08
207 0.09
208 0.09
209 0.08
210 0.08
211 0.08
212 0.08
213 0.08
214 0.11
215 0.13
216 0.15
217 0.16
218 0.18
219 0.16
220 0.25
221 0.28
222 0.27
223 0.25
224 0.23
225 0.23
226 0.23
227 0.25
228 0.16
229 0.13
230 0.11
231 0.14
232 0.14
233 0.13
234 0.12
235 0.14
236 0.17
237 0.19
238 0.19
239 0.17
240 0.19
241 0.2
242 0.2
243 0.15
244 0.13
245 0.11
246 0.11
247 0.1
248 0.09
249 0.07
250 0.06
251 0.06
252 0.05
253 0.05
254 0.05
255 0.06
256 0.06
257 0.06
258 0.06
259 0.08
260 0.07
261 0.09
262 0.14
263 0.14
264 0.15
265 0.16
266 0.16
267 0.16
268 0.17
269 0.15
270 0.13
271 0.14
272 0.13
273 0.13
274 0.13
275 0.13
276 0.12
277 0.11
278 0.1
279 0.11
280 0.12
281 0.14
282 0.14
283 0.15
284 0.16
285 0.17
286 0.19
287 0.16
288 0.18
289 0.18
290 0.19
291 0.21
292 0.23
293 0.21
294 0.21
295 0.24
296 0.2
297 0.21
298 0.21
299 0.21
300 0.26
301 0.3
302 0.34
303 0.33
304 0.34
305 0.33
306 0.35
307 0.35
308 0.26
309 0.24
310 0.22
311 0.22
312 0.19
313 0.18
314 0.15
315 0.15
316 0.16
317 0.14
318 0.13
319 0.13
320 0.13
321 0.14
322 0.15
323 0.13
324 0.11
325 0.18
326 0.17
327 0.25
328 0.25
329 0.24
330 0.25
331 0.25
332 0.27
333 0.2
334 0.18
335 0.09
336 0.11
337 0.12
338 0.1
339 0.1
340 0.09
341 0.1
342 0.1
343 0.13
344 0.12
345 0.14
346 0.19
347 0.26
348 0.29
349 0.28
350 0.28
351 0.26
352 0.26
353 0.24
354 0.19
355 0.13
356 0.1
357 0.09
358 0.11
359 0.11
360 0.14
361 0.14
362 0.13
363 0.16
364 0.17
365 0.18
366 0.26
367 0.28
368 0.26
369 0.27
370 0.27
371 0.28
372 0.27
373 0.27
374 0.19
375 0.16
376 0.15
377 0.15
378 0.14
379 0.09
380 0.09
381 0.07
382 0.06
383 0.07
384 0.07
385 0.06
386 0.06
387 0.07
388 0.07
389 0.08
390 0.09
391 0.1
392 0.1
393 0.11
394 0.11
395 0.11
396 0.12
397 0.11
398 0.14
399 0.15
400 0.19
401 0.26
402 0.31
403 0.33
404 0.35
405 0.45
406 0.48
407 0.56
408 0.57
409 0.6
410 0.66
411 0.72
412 0.79