Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A093YJL5

Protein Details
Accession A0A093YJL5    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-25STEQTVAKKRGRPRKNPLPETASPHydrophilic
NLS Segment(s)
PositionSequence
9-18KKRGRPRKNP
50-55KPRTRK
146-180HPRTPSKTSSPKPPSKTAAATPPPKSAPPTKPPAP
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSTEQTVAKKRGRPRKNPLPETASPSSPAPAKTTTARKTAPKTTSTEPTKPRTRKAKTPAPETPSPEAAMPITPNQPAAAAPAPSPIPESIESPNQTTSSVPPLPRPTASATPPHRPSAILTAVRELSTKASPAPKPAASTKPVSHPRTPSKTSSPKPPSKTAAATPPPKSAPPTKPPAPKIPLGALNAKIVDNISKPAGARPSAGGQQQLPPGYKPVARKVTMTIVALPIAIVTSYVLWQRLVMGEEQKVLVRPPPVGDVDTQEKGPESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.87
4 0.88
5 0.86
6 0.84
7 0.78
8 0.76
9 0.69
10 0.59
11 0.51
12 0.44
13 0.39
14 0.33
15 0.3
16 0.26
17 0.24
18 0.26
19 0.3
20 0.39
21 0.41
22 0.44
23 0.48
24 0.52
25 0.56
26 0.62
27 0.6
28 0.55
29 0.56
30 0.54
31 0.59
32 0.59
33 0.6
34 0.58
35 0.61
36 0.68
37 0.68
38 0.71
39 0.72
40 0.72
41 0.74
42 0.76
43 0.77
44 0.75
45 0.78
46 0.77
47 0.74
48 0.72
49 0.68
50 0.63
51 0.55
52 0.48
53 0.39
54 0.32
55 0.25
56 0.2
57 0.16
58 0.14
59 0.15
60 0.14
61 0.14
62 0.13
63 0.13
64 0.12
65 0.14
66 0.13
67 0.12
68 0.11
69 0.13
70 0.13
71 0.13
72 0.15
73 0.11
74 0.12
75 0.12
76 0.14
77 0.15
78 0.2
79 0.21
80 0.21
81 0.23
82 0.2
83 0.2
84 0.18
85 0.17
86 0.18
87 0.2
88 0.19
89 0.22
90 0.26
91 0.28
92 0.28
93 0.28
94 0.27
95 0.27
96 0.29
97 0.33
98 0.33
99 0.39
100 0.42
101 0.41
102 0.37
103 0.33
104 0.32
105 0.29
106 0.3
107 0.24
108 0.21
109 0.22
110 0.22
111 0.21
112 0.2
113 0.15
114 0.12
115 0.1
116 0.1
117 0.1
118 0.15
119 0.15
120 0.18
121 0.22
122 0.2
123 0.22
124 0.26
125 0.28
126 0.25
127 0.28
128 0.26
129 0.31
130 0.4
131 0.42
132 0.42
133 0.45
134 0.51
135 0.54
136 0.56
137 0.52
138 0.52
139 0.57
140 0.56
141 0.6
142 0.61
143 0.61
144 0.63
145 0.64
146 0.59
147 0.54
148 0.54
149 0.45
150 0.46
151 0.45
152 0.46
153 0.43
154 0.43
155 0.4
156 0.38
157 0.39
158 0.38
159 0.38
160 0.38
161 0.44
162 0.48
163 0.54
164 0.57
165 0.62
166 0.58
167 0.54
168 0.5
169 0.46
170 0.43
171 0.38
172 0.37
173 0.3
174 0.28
175 0.26
176 0.23
177 0.19
178 0.15
179 0.14
180 0.11
181 0.12
182 0.11
183 0.11
184 0.12
185 0.15
186 0.18
187 0.17
188 0.17
189 0.18
190 0.21
191 0.23
192 0.24
193 0.23
194 0.21
195 0.24
196 0.27
197 0.27
198 0.25
199 0.22
200 0.24
201 0.25
202 0.27
203 0.28
204 0.33
205 0.38
206 0.38
207 0.39
208 0.4
209 0.44
210 0.43
211 0.4
212 0.32
213 0.25
214 0.24
215 0.22
216 0.18
217 0.11
218 0.08
219 0.06
220 0.05
221 0.04
222 0.05
223 0.06
224 0.09
225 0.1
226 0.1
227 0.1
228 0.11
229 0.13
230 0.13
231 0.15
232 0.17
233 0.18
234 0.19
235 0.2
236 0.2
237 0.19
238 0.19
239 0.21
240 0.19
241 0.19
242 0.2
243 0.23
244 0.24
245 0.25
246 0.25
247 0.27
248 0.32
249 0.32
250 0.3
251 0.27