Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093YCQ5

Protein Details
Accession A0A093YCQ5   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-70DHLFQKKRTNTPKVMPNPKPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15.5, cyto_nucl 12.5, nucl 6.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR017850  Alkaline_phosphatase_core_sf  
Amino Acid Sequences PYLEKGHVEHEGVNSAGKTEIYSATSVLRTLGYLWDFEPFTPRVEASPSFDHLFQKKRTNTPKVMPNPKPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.13
4 0.11
5 0.1
6 0.09
7 0.1
8 0.1
9 0.1
10 0.1
11 0.11
12 0.11
13 0.11
14 0.1
15 0.08
16 0.07
17 0.07
18 0.09
19 0.08
20 0.08
21 0.08
22 0.09
23 0.09
24 0.09
25 0.12
26 0.11
27 0.12
28 0.12
29 0.12
30 0.11
31 0.14
32 0.15
33 0.17
34 0.19
35 0.21
36 0.22
37 0.23
38 0.27
39 0.29
40 0.34
41 0.35
42 0.42
43 0.45
44 0.53
45 0.62
46 0.66
47 0.68
48 0.7
49 0.74
50 0.76
51 0.8