Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093YHC6

Protein Details
Accession A0A093YHC6   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
168-192LPQVGKDASKRRKPKNNMAKSNSSFHydrophilic
NLS Segment(s)
PositionSequence
177-182KRRKPK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, extr 4, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MFVLPPPPRYPTHAAYNAAIAAGQVPPMIETNNILSTPTGPEYQLLVGEGTYVLKEDLHLATPPPHPSEAPIINPNPLATTPQPASAGTKISLLSLSTRSSAPSYFRQRANSRLSAPIHEHPGEERTSAELSSEGGAGSPRSSNITGPLSHTSNASTPAFGEGNSLLLPQVGKDASKRRKPKNNMAKSNSSFISRVITNEGLAKRLADRPSDGLFAFVNVNRAFQWLDLSSPNKIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.46
4 0.39
5 0.32
6 0.26
7 0.17
8 0.11
9 0.08
10 0.08
11 0.06
12 0.05
13 0.06
14 0.07
15 0.08
16 0.08
17 0.09
18 0.12
19 0.14
20 0.14
21 0.14
22 0.13
23 0.14
24 0.17
25 0.17
26 0.15
27 0.13
28 0.14
29 0.15
30 0.15
31 0.14
32 0.12
33 0.1
34 0.08
35 0.08
36 0.08
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.08
44 0.08
45 0.1
46 0.1
47 0.11
48 0.15
49 0.18
50 0.21
51 0.21
52 0.21
53 0.19
54 0.21
55 0.26
56 0.24
57 0.25
58 0.28
59 0.26
60 0.26
61 0.26
62 0.24
63 0.19
64 0.17
65 0.17
66 0.13
67 0.16
68 0.16
69 0.17
70 0.18
71 0.17
72 0.2
73 0.17
74 0.18
75 0.14
76 0.14
77 0.13
78 0.12
79 0.12
80 0.09
81 0.1
82 0.1
83 0.1
84 0.1
85 0.1
86 0.11
87 0.12
88 0.13
89 0.14
90 0.21
91 0.28
92 0.32
93 0.34
94 0.4
95 0.41
96 0.47
97 0.5
98 0.45
99 0.39
100 0.4
101 0.38
102 0.34
103 0.35
104 0.3
105 0.28
106 0.25
107 0.23
108 0.18
109 0.2
110 0.18
111 0.14
112 0.13
113 0.1
114 0.1
115 0.1
116 0.09
117 0.07
118 0.07
119 0.07
120 0.07
121 0.05
122 0.05
123 0.05
124 0.05
125 0.06
126 0.05
127 0.05
128 0.08
129 0.09
130 0.09
131 0.12
132 0.14
133 0.14
134 0.17
135 0.2
136 0.19
137 0.19
138 0.19
139 0.17
140 0.16
141 0.19
142 0.16
143 0.13
144 0.11
145 0.14
146 0.14
147 0.12
148 0.13
149 0.09
150 0.1
151 0.1
152 0.09
153 0.06
154 0.07
155 0.07
156 0.05
157 0.08
158 0.07
159 0.08
160 0.13
161 0.23
162 0.32
163 0.42
164 0.51
165 0.59
166 0.69
167 0.78
168 0.84
169 0.85
170 0.87
171 0.88
172 0.86
173 0.86
174 0.78
175 0.74
176 0.64
177 0.56
178 0.46
179 0.36
180 0.33
181 0.23
182 0.22
183 0.21
184 0.21
185 0.18
186 0.24
187 0.24
188 0.21
189 0.21
190 0.2
191 0.19
192 0.24
193 0.26
194 0.22
195 0.25
196 0.28
197 0.3
198 0.32
199 0.29
200 0.24
201 0.22
202 0.21
203 0.21
204 0.17
205 0.2
206 0.18
207 0.19
208 0.18
209 0.2
210 0.19
211 0.16
212 0.2
213 0.15
214 0.17
215 0.22
216 0.25