Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A093YQR8

Protein Details
Accession A0A093YQR8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
45-78ERDRHNSTKMRAKWRKKRTRRLKRKRRKTRARSKBasic
NLS Segment(s)
PositionSequence
50-78NSTKMRAKWRKKRTRRLKRKRRKTRARSK
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MAGLGSMLPLPCLSGTLGAATDVKAQEERRYQKLKSNHSSGCNRERDRHNSTKMRAKWRKKRTRRLKRKRRKTRARSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.08
5 0.08
6 0.09
7 0.08
8 0.11
9 0.1
10 0.11
11 0.13
12 0.14
13 0.18
14 0.26
15 0.3
16 0.35
17 0.39
18 0.39
19 0.44
20 0.51
21 0.55
22 0.54
23 0.56
24 0.52
25 0.53
26 0.58
27 0.55
28 0.55
29 0.54
30 0.5
31 0.5
32 0.53
33 0.54
34 0.57
35 0.6
36 0.61
37 0.61
38 0.64
39 0.67
40 0.67
41 0.71
42 0.73
43 0.75
44 0.78
45 0.81
46 0.87
47 0.89
48 0.93
49 0.93
50 0.95
51 0.95
52 0.96
53 0.97
54 0.97
55 0.97
56 0.98
57 0.97
58 0.97