Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094AAY6

Protein Details
Accession A0A094AAY6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-33APLSGKKARKVEKARNHAKQRAHydrophilic
NLS Segment(s)
PositionSequence
16-32GKKARKVEKARNHAKQR
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences SSVLHPNSGPLAPLSGKKARKVEKARNHAKQRALEKELAERGEVAMTDAPVTTKSKAKASAGAESMDVDEAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.3
4 0.35
5 0.43
6 0.47
7 0.55
8 0.62
9 0.67
10 0.7
11 0.77
12 0.81
13 0.82
14 0.84
15 0.8
16 0.76
17 0.72
18 0.68
19 0.64
20 0.58
21 0.5
22 0.42
23 0.4
24 0.37
25 0.31
26 0.25
27 0.18
28 0.15
29 0.12
30 0.11
31 0.08
32 0.07
33 0.06
34 0.06
35 0.06
36 0.06
37 0.08
38 0.1
39 0.11
40 0.15
41 0.18
42 0.22
43 0.26
44 0.28
45 0.33
46 0.34
47 0.38
48 0.35
49 0.34
50 0.3
51 0.27
52 0.25