Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JFF7

Protein Details
Accession C4JFF7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-29TLRQCRQYWRHIPVRQCRQFTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002023  NuoE-like  
IPR042128  NuoE_dom  
IPR041921  NuoE_N  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0051537  F:2 iron, 2 sulfur cluster binding  
GO:0046872  F:metal ion binding  
GO:0016491  F:oxidoreductase activity  
KEGG ure:UREG_00971  -  
Pfam View protein in Pfam  
PF01257  2Fe-2S_thioredx  
PROSITE View protein in PROSITE  
PS01099  COMPLEX1_24K  
CDD cd03064  TRX_Fd_NuoE  
Amino Acid Sequences MASKLVPFTLRQCRQYWRHIPVRQCRQFTVATPVRSEALAVHRNSPENNPNIPFKFTEQNLKVIDEIVKRYPPQYKKAAVMPLLDLGQRQLGWTSISVMNEVARILEMPPMRVYEVATFYTMYNRDPVGKYFVQICTTTPCQLGGCGSDKIVEAITKHLGVHSHGQTTPDKLFTVLEVECLGACVNAPMVQINDEYYEDLTPDTAVQLLEALKESALAGESGKKVKVPAPGPLSGRHSCENSAGLTNLTSPLWSTETLRTDGEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.66
3 0.68
4 0.66
5 0.69
6 0.71
7 0.76
8 0.78
9 0.83
10 0.81
11 0.75
12 0.69
13 0.63
14 0.59
15 0.52
16 0.52
17 0.47
18 0.41
19 0.38
20 0.37
21 0.34
22 0.31
23 0.29
24 0.21
25 0.22
26 0.27
27 0.26
28 0.3
29 0.31
30 0.34
31 0.35
32 0.39
33 0.38
34 0.36
35 0.39
36 0.37
37 0.41
38 0.41
39 0.42
40 0.37
41 0.34
42 0.36
43 0.34
44 0.41
45 0.36
46 0.4
47 0.39
48 0.38
49 0.34
50 0.29
51 0.31
52 0.24
53 0.25
54 0.23
55 0.24
56 0.24
57 0.27
58 0.34
59 0.35
60 0.39
61 0.43
62 0.43
63 0.43
64 0.48
65 0.5
66 0.43
67 0.39
68 0.34
69 0.28
70 0.25
71 0.21
72 0.16
73 0.11
74 0.1
75 0.09
76 0.08
77 0.07
78 0.07
79 0.07
80 0.08
81 0.11
82 0.11
83 0.12
84 0.12
85 0.12
86 0.11
87 0.11
88 0.1
89 0.07
90 0.05
91 0.05
92 0.05
93 0.09
94 0.09
95 0.1
96 0.1
97 0.11
98 0.11
99 0.11
100 0.12
101 0.1
102 0.12
103 0.11
104 0.11
105 0.11
106 0.11
107 0.14
108 0.13
109 0.12
110 0.11
111 0.11
112 0.13
113 0.13
114 0.14
115 0.17
116 0.16
117 0.17
118 0.18
119 0.18
120 0.18
121 0.17
122 0.17
123 0.15
124 0.17
125 0.18
126 0.15
127 0.15
128 0.13
129 0.13
130 0.13
131 0.1
132 0.11
133 0.1
134 0.1
135 0.1
136 0.1
137 0.1
138 0.1
139 0.09
140 0.07
141 0.09
142 0.1
143 0.09
144 0.09
145 0.1
146 0.1
147 0.11
148 0.17
149 0.16
150 0.18
151 0.18
152 0.21
153 0.21
154 0.24
155 0.23
156 0.18
157 0.17
158 0.15
159 0.14
160 0.12
161 0.14
162 0.1
163 0.1
164 0.09
165 0.09
166 0.08
167 0.08
168 0.08
169 0.05
170 0.05
171 0.04
172 0.04
173 0.05
174 0.06
175 0.06
176 0.07
177 0.08
178 0.08
179 0.09
180 0.1
181 0.09
182 0.1
183 0.1
184 0.1
185 0.09
186 0.09
187 0.08
188 0.07
189 0.06
190 0.06
191 0.06
192 0.06
193 0.05
194 0.07
195 0.07
196 0.07
197 0.08
198 0.08
199 0.07
200 0.07
201 0.07
202 0.06
203 0.06
204 0.06
205 0.06
206 0.1
207 0.13
208 0.15
209 0.16
210 0.16
211 0.18
212 0.21
213 0.29
214 0.27
215 0.33
216 0.36
217 0.4
218 0.42
219 0.45
220 0.48
221 0.43
222 0.45
223 0.41
224 0.38
225 0.34
226 0.35
227 0.31
228 0.27
229 0.26
230 0.23
231 0.2
232 0.17
233 0.17
234 0.16
235 0.14
236 0.12
237 0.1
238 0.12
239 0.13
240 0.14
241 0.17
242 0.22
243 0.26
244 0.29