Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JYL6

Protein Details
Accession C4JYL6   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-31IPTSQDPRSKRPLKRRALTPLSEHydrophilic
118-150EEMRRKDEEKTDKNRKRREKRKAAKAKKGAGPSBasic
NLS Segment(s)
PositionSequence
115-148KRKEEMRRKDEEKTDKNRKRREKRKAAKAKKGAG
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
KEGG ure:UREG_07267  -  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSEPIPESIPTSQDPRSKRPLKRRALTPLSEQAKQLESLFKDPSKEIHIPAVSKQRTAASLPAPPEIVANVQGSSAGAGSGEFHVYKASRRREYERVRLMEQDLNREKANEDFEKRKEEMRRKDEEKTDKNRKRREKRKAAKAKKGAGPSAAIAEDGDMAVDRLGAPHGSFSGKEQNTIEPETSNSHVETPGVIIHDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.42
3 0.51
4 0.57
5 0.64
6 0.71
7 0.75
8 0.8
9 0.83
10 0.84
11 0.84
12 0.83
13 0.77
14 0.73
15 0.73
16 0.66
17 0.59
18 0.51
19 0.43
20 0.37
21 0.34
22 0.28
23 0.24
24 0.22
25 0.24
26 0.28
27 0.27
28 0.27
29 0.27
30 0.28
31 0.29
32 0.29
33 0.26
34 0.28
35 0.29
36 0.28
37 0.33
38 0.4
39 0.34
40 0.33
41 0.33
42 0.27
43 0.27
44 0.27
45 0.26
46 0.19
47 0.22
48 0.23
49 0.22
50 0.21
51 0.19
52 0.17
53 0.14
54 0.12
55 0.1
56 0.09
57 0.08
58 0.08
59 0.08
60 0.07
61 0.07
62 0.06
63 0.04
64 0.03
65 0.03
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.07
72 0.07
73 0.12
74 0.19
75 0.26
76 0.31
77 0.35
78 0.41
79 0.49
80 0.56
81 0.61
82 0.61
83 0.58
84 0.53
85 0.51
86 0.48
87 0.41
88 0.35
89 0.34
90 0.28
91 0.27
92 0.25
93 0.24
94 0.22
95 0.21
96 0.25
97 0.21
98 0.22
99 0.25
100 0.28
101 0.32
102 0.33
103 0.37
104 0.4
105 0.46
106 0.52
107 0.54
108 0.6
109 0.59
110 0.65
111 0.67
112 0.68
113 0.68
114 0.68
115 0.72
116 0.72
117 0.78
118 0.81
119 0.84
120 0.85
121 0.87
122 0.88
123 0.88
124 0.91
125 0.92
126 0.94
127 0.93
128 0.93
129 0.91
130 0.88
131 0.83
132 0.77
133 0.68
134 0.58
135 0.49
136 0.39
137 0.32
138 0.24
139 0.18
140 0.12
141 0.11
142 0.09
143 0.07
144 0.06
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.05
152 0.06
153 0.06
154 0.07
155 0.08
156 0.1
157 0.1
158 0.13
159 0.23
160 0.22
161 0.26
162 0.26
163 0.3
164 0.32
165 0.35
166 0.33
167 0.23
168 0.25
169 0.27
170 0.28
171 0.25
172 0.22
173 0.21
174 0.2
175 0.19
176 0.18
177 0.15
178 0.14
179 0.13