Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093XUR3

Protein Details
Accession A0A093XUR3    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
249-281AEAEARREKNRMKKAKQKERKRKEKEQALAAAGBasic
NLS Segment(s)
PositionSequence
140-153GKSKKAKREVAKAA
253-273ARREKNRMKKAKQKERKRKEK
Subcellular Location(s) nucl 18.5, cyto_nucl 13.333, mito_nucl 11.166, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR021641  DUF3245  
Pfam View protein in Pfam  
PF11595  DUF3245  
Amino Acid Sequences MAPTTKEKLPVAANLEDIQARIDLAIAKRDAIVKSWVDKFDTSKCAPSKTKEELEAWDAELFNPMPSNLGLGAPLPKEYLNGDMNRKDNSGNSKLRSLMMGKKAGLQAAKPRDAEEKANSMKRGLKEDTSDEEEGRSNLGKSKKAKREVAKAAALKTAAFKAVKQTKPLPLQQKAAASTTLEAVGQSDDEDSRAASLAPKVNSKPKITKLTETTPSTSELPSIPVVAEKKVAVKVDSPAKAVVEPPLSAEAEARREKNRMKKAKQKERKRKEKEQALAAAGSVKTDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.26
4 0.23
5 0.18
6 0.13
7 0.11
8 0.09
9 0.09
10 0.11
11 0.12
12 0.18
13 0.17
14 0.17
15 0.19
16 0.23
17 0.22
18 0.21
19 0.25
20 0.22
21 0.27
22 0.32
23 0.32
24 0.31
25 0.33
26 0.34
27 0.35
28 0.4
29 0.36
30 0.39
31 0.4
32 0.44
33 0.47
34 0.49
35 0.51
36 0.51
37 0.54
38 0.5
39 0.5
40 0.46
41 0.45
42 0.4
43 0.33
44 0.28
45 0.23
46 0.19
47 0.19
48 0.16
49 0.12
50 0.12
51 0.1
52 0.09
53 0.09
54 0.1
55 0.08
56 0.08
57 0.08
58 0.08
59 0.11
60 0.1
61 0.1
62 0.1
63 0.1
64 0.11
65 0.11
66 0.15
67 0.17
68 0.2
69 0.25
70 0.28
71 0.3
72 0.31
73 0.31
74 0.27
75 0.27
76 0.3
77 0.33
78 0.35
79 0.35
80 0.36
81 0.36
82 0.36
83 0.34
84 0.3
85 0.29
86 0.29
87 0.3
88 0.27
89 0.3
90 0.3
91 0.3
92 0.27
93 0.22
94 0.24
95 0.27
96 0.3
97 0.27
98 0.27
99 0.3
100 0.31
101 0.33
102 0.28
103 0.29
104 0.3
105 0.33
106 0.32
107 0.3
108 0.33
109 0.31
110 0.33
111 0.29
112 0.26
113 0.24
114 0.27
115 0.28
116 0.29
117 0.28
118 0.22
119 0.21
120 0.2
121 0.18
122 0.16
123 0.12
124 0.08
125 0.12
126 0.15
127 0.19
128 0.25
129 0.35
130 0.42
131 0.49
132 0.56
133 0.56
134 0.63
135 0.64
136 0.63
137 0.59
138 0.53
139 0.47
140 0.41
141 0.36
142 0.27
143 0.21
144 0.16
145 0.13
146 0.11
147 0.1
148 0.17
149 0.26
150 0.28
151 0.31
152 0.34
153 0.39
154 0.43
155 0.5
156 0.49
157 0.45
158 0.46
159 0.45
160 0.45
161 0.39
162 0.35
163 0.3
164 0.22
165 0.18
166 0.15
167 0.12
168 0.09
169 0.07
170 0.06
171 0.06
172 0.05
173 0.05
174 0.05
175 0.05
176 0.06
177 0.06
178 0.05
179 0.05
180 0.06
181 0.06
182 0.06
183 0.1
184 0.14
185 0.16
186 0.2
187 0.23
188 0.31
189 0.35
190 0.39
191 0.43
192 0.46
193 0.54
194 0.54
195 0.58
196 0.56
197 0.58
198 0.6
199 0.56
200 0.51
201 0.43
202 0.42
203 0.37
204 0.31
205 0.25
206 0.18
207 0.17
208 0.15
209 0.14
210 0.11
211 0.14
212 0.15
213 0.14
214 0.16
215 0.14
216 0.17
217 0.19
218 0.21
219 0.18
220 0.19
221 0.24
222 0.31
223 0.32
224 0.3
225 0.28
226 0.28
227 0.27
228 0.26
229 0.25
230 0.19
231 0.17
232 0.17
233 0.19
234 0.18
235 0.18
236 0.19
237 0.18
238 0.23
239 0.28
240 0.3
241 0.31
242 0.37
243 0.44
244 0.53
245 0.6
246 0.64
247 0.69
248 0.76
249 0.83
250 0.89
251 0.92
252 0.93
253 0.94
254 0.94
255 0.95
256 0.95
257 0.94
258 0.94
259 0.94
260 0.9
261 0.88
262 0.83
263 0.75
264 0.65
265 0.54
266 0.48
267 0.37