Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094AW67

Protein Details
Accession A0A094AW67   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-103FSNKALKRKGAKSFLKKKFLKHydrophilic
NLS Segment(s)
PositionSequence
88-100LKRKGAKSFLKKK
Subcellular Location(s) plas 17, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002656  Acyl_transf_3_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0016747  F:acyltransferase activity, transferring groups other than amino-acyl groups  
Pfam View protein in Pfam  
PF01757  Acyl_transf_3  
Amino Acid Sequences MAPTQSKLVTQDQTDRLYYLDNFRSYLTALVIYHHAAAPYGGIGIWFYRSELYPPGSSIALSVFNAVNQSYFMGSFFFLAGYFSNKALKRKGAKSFLKKKFLKLGVPVVVYSLLAGPAQIALLKLYKGEVLGWEILTEYWKALDGVKGTMWFSSLLLIFDSVAALCPSIPPFLAQSGILPSFILDIGSSCLIRFANPTGAKFTPLNLKPAYLPQYVSSYVLGASLGSPPTPPITKTTRNVLASSAVLSTASLGLQLNNLRPINVGAIIGGFSLPALTYAIANETTGYLLGTTILRFFQTSKWLNRPWGSIGKYSYAAFLIHPIVCVAAQVWTDEWKALPVVKATVIGTVSIVGSWGVGWALVRVPGFGSVLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.39
3 0.33
4 0.33
5 0.31
6 0.31
7 0.32
8 0.3
9 0.29
10 0.3
11 0.3
12 0.27
13 0.26
14 0.19
15 0.15
16 0.14
17 0.15
18 0.16
19 0.16
20 0.17
21 0.16
22 0.14
23 0.12
24 0.12
25 0.1
26 0.08
27 0.07
28 0.06
29 0.05
30 0.06
31 0.06
32 0.08
33 0.08
34 0.08
35 0.1
36 0.11
37 0.13
38 0.17
39 0.2
40 0.19
41 0.2
42 0.21
43 0.2
44 0.19
45 0.17
46 0.14
47 0.13
48 0.12
49 0.13
50 0.11
51 0.11
52 0.12
53 0.12
54 0.1
55 0.09
56 0.09
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.07
65 0.06
66 0.07
67 0.07
68 0.1
69 0.12
70 0.12
71 0.19
72 0.22
73 0.26
74 0.3
75 0.37
76 0.42
77 0.48
78 0.56
79 0.6
80 0.66
81 0.73
82 0.8
83 0.81
84 0.83
85 0.78
86 0.75
87 0.74
88 0.7
89 0.63
90 0.57
91 0.55
92 0.49
93 0.48
94 0.42
95 0.33
96 0.28
97 0.23
98 0.18
99 0.1
100 0.06
101 0.05
102 0.05
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.06
110 0.06
111 0.06
112 0.06
113 0.07
114 0.07
115 0.07
116 0.07
117 0.08
118 0.09
119 0.09
120 0.08
121 0.08
122 0.08
123 0.09
124 0.08
125 0.06
126 0.05
127 0.06
128 0.06
129 0.06
130 0.08
131 0.08
132 0.09
133 0.1
134 0.11
135 0.11
136 0.1
137 0.1
138 0.08
139 0.07
140 0.08
141 0.08
142 0.07
143 0.07
144 0.07
145 0.06
146 0.06
147 0.06
148 0.04
149 0.04
150 0.04
151 0.04
152 0.03
153 0.04
154 0.05
155 0.05
156 0.05
157 0.05
158 0.06
159 0.07
160 0.07
161 0.07
162 0.07
163 0.09
164 0.09
165 0.08
166 0.07
167 0.07
168 0.06
169 0.06
170 0.06
171 0.03
172 0.04
173 0.05
174 0.05
175 0.05
176 0.05
177 0.06
178 0.06
179 0.06
180 0.07
181 0.08
182 0.15
183 0.16
184 0.17
185 0.2
186 0.21
187 0.23
188 0.22
189 0.22
190 0.23
191 0.23
192 0.27
193 0.22
194 0.23
195 0.21
196 0.26
197 0.29
198 0.21
199 0.21
200 0.18
201 0.2
202 0.2
203 0.21
204 0.16
205 0.11
206 0.1
207 0.1
208 0.08
209 0.05
210 0.05
211 0.06
212 0.06
213 0.05
214 0.05
215 0.06
216 0.08
217 0.09
218 0.1
219 0.13
220 0.2
221 0.26
222 0.29
223 0.35
224 0.4
225 0.41
226 0.4
227 0.37
228 0.32
229 0.26
230 0.24
231 0.17
232 0.1
233 0.09
234 0.08
235 0.07
236 0.05
237 0.05
238 0.05
239 0.05
240 0.05
241 0.08
242 0.1
243 0.11
244 0.16
245 0.16
246 0.16
247 0.16
248 0.17
249 0.16
250 0.15
251 0.13
252 0.07
253 0.07
254 0.07
255 0.07
256 0.06
257 0.04
258 0.03
259 0.03
260 0.03
261 0.03
262 0.04
263 0.04
264 0.04
265 0.05
266 0.07
267 0.07
268 0.07
269 0.07
270 0.07
271 0.07
272 0.07
273 0.06
274 0.05
275 0.05
276 0.06
277 0.06
278 0.06
279 0.07
280 0.07
281 0.08
282 0.08
283 0.1
284 0.12
285 0.2
286 0.27
287 0.32
288 0.4
289 0.44
290 0.5
291 0.51
292 0.52
293 0.48
294 0.51
295 0.47
296 0.44
297 0.42
298 0.39
299 0.38
300 0.35
301 0.3
302 0.23
303 0.2
304 0.15
305 0.16
306 0.16
307 0.14
308 0.14
309 0.13
310 0.13
311 0.12
312 0.12
313 0.09
314 0.08
315 0.09
316 0.09
317 0.1
318 0.12
319 0.13
320 0.14
321 0.14
322 0.12
323 0.14
324 0.15
325 0.16
326 0.16
327 0.17
328 0.17
329 0.19
330 0.18
331 0.19
332 0.17
333 0.15
334 0.13
335 0.12
336 0.11
337 0.09
338 0.09
339 0.06
340 0.06
341 0.05
342 0.05
343 0.04
344 0.05
345 0.05
346 0.06
347 0.07
348 0.1
349 0.1
350 0.1
351 0.11
352 0.12