Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094AP88

Protein Details
Accession A0A094AP88    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-32SDEGNPTRIRNNQRRSRARRKDYLQEIERHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MPDSDEGNPTRIRNNQRRSRARRKDYLQEIERQLRQCELTGVEASPEIQSAARKVLDENRRLRTLLVQHGVNPDVTSDDDGSPPNNDPVSDAKAFESPSVGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.72
4 0.81
5 0.86
6 0.89
7 0.9
8 0.89
9 0.88
10 0.85
11 0.84
12 0.82
13 0.82
14 0.74
15 0.7
16 0.67
17 0.64
18 0.62
19 0.54
20 0.45
21 0.37
22 0.34
23 0.27
24 0.23
25 0.17
26 0.15
27 0.13
28 0.12
29 0.11
30 0.1
31 0.1
32 0.08
33 0.07
34 0.05
35 0.05
36 0.06
37 0.06
38 0.08
39 0.08
40 0.08
41 0.09
42 0.17
43 0.23
44 0.29
45 0.34
46 0.37
47 0.38
48 0.38
49 0.38
50 0.35
51 0.33
52 0.33
53 0.31
54 0.27
55 0.27
56 0.29
57 0.29
58 0.25
59 0.2
60 0.13
61 0.11
62 0.11
63 0.11
64 0.11
65 0.11
66 0.12
67 0.13
68 0.14
69 0.14
70 0.15
71 0.17
72 0.16
73 0.15
74 0.16
75 0.2
76 0.25
77 0.24
78 0.23
79 0.22
80 0.24
81 0.25
82 0.23