Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094AND7

Protein Details
Accession A0A094AND7    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
31-50ELNVVKRKSRRNGAAREQNEHydrophilic
NLS Segment(s)
PositionSequence
13-27HGGRGGRRSGRNHGG
36-41KRKSRR
Subcellular Location(s) mito 12, nucl 7.5, cyto_nucl 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MADTYRGGRDGGHGGRGGRRSGRNHGGSNGELNVVKRKSRRNGAAREQNELGGDNVPPHELNGEEEITLPDGPVIPLLANERIWNGEGHGVFEGGPNNGWSYAGQNEPIPGYRVPDNAWSYGGQNNPIPGAQQPGNNRPAPGGQLVGLDEFPCYSPVDTWAGDASRGNNPMTDLFFDFGPNGGHPAPNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.33
4 0.34
5 0.33
6 0.38
7 0.4
8 0.47
9 0.55
10 0.55
11 0.55
12 0.55
13 0.52
14 0.46
15 0.44
16 0.36
17 0.28
18 0.24
19 0.22
20 0.27
21 0.25
22 0.28
23 0.32
24 0.4
25 0.46
26 0.55
27 0.63
28 0.64
29 0.72
30 0.77
31 0.82
32 0.74
33 0.71
34 0.63
35 0.53
36 0.45
37 0.36
38 0.26
39 0.16
40 0.15
41 0.1
42 0.1
43 0.1
44 0.09
45 0.08
46 0.08
47 0.07
48 0.09
49 0.1
50 0.11
51 0.1
52 0.1
53 0.1
54 0.11
55 0.1
56 0.08
57 0.06
58 0.06
59 0.06
60 0.05
61 0.05
62 0.04
63 0.04
64 0.07
65 0.08
66 0.08
67 0.08
68 0.08
69 0.09
70 0.1
71 0.09
72 0.08
73 0.1
74 0.1
75 0.1
76 0.1
77 0.09
78 0.09
79 0.1
80 0.1
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.05
88 0.06
89 0.08
90 0.08
91 0.09
92 0.09
93 0.09
94 0.1
95 0.1
96 0.11
97 0.09
98 0.11
99 0.12
100 0.13
101 0.14
102 0.19
103 0.2
104 0.19
105 0.2
106 0.18
107 0.18
108 0.2
109 0.2
110 0.16
111 0.15
112 0.15
113 0.14
114 0.13
115 0.13
116 0.1
117 0.14
118 0.14
119 0.17
120 0.22
121 0.28
122 0.33
123 0.34
124 0.33
125 0.3
126 0.29
127 0.27
128 0.23
129 0.18
130 0.13
131 0.13
132 0.13
133 0.13
134 0.12
135 0.09
136 0.08
137 0.08
138 0.08
139 0.08
140 0.09
141 0.09
142 0.09
143 0.12
144 0.15
145 0.14
146 0.15
147 0.16
148 0.16
149 0.16
150 0.17
151 0.17
152 0.19
153 0.21
154 0.21
155 0.19
156 0.2
157 0.22
158 0.22
159 0.23
160 0.19
161 0.18
162 0.18
163 0.18
164 0.16
165 0.15
166 0.15
167 0.12
168 0.15
169 0.14