Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094C8U8

Protein Details
Accession A0A094C8U8   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
98-117RRLRAANERQKKKRAVRRSYBasic
NLS Segment(s)
PositionSequence
101-114RAANERQKKKRAVR
Subcellular Location(s) nucl 14.5, cyto_nucl 9.833, mito 8.5, cyto_mito 6.833
Family & Domain DBs
Amino Acid Sequences GFAATGLVPYNPERVLSKLNTQLRTPTPPLPTLNQQSPWAPETPHNIRELECQASVIQGFIQRRTAGSSSPTDQAVQQLVKGCQMAMHSAVLLADENRRLRAANERQKKKRAVRRSYIATGGVLTAQEGLNRSKSTDLQVMGQSTGGAEEQRIRAPQMSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.25
3 0.26
4 0.31
5 0.37
6 0.44
7 0.45
8 0.44
9 0.47
10 0.46
11 0.49
12 0.47
13 0.44
14 0.41
15 0.42
16 0.44
17 0.42
18 0.45
19 0.45
20 0.46
21 0.42
22 0.41
23 0.39
24 0.39
25 0.36
26 0.3
27 0.25
28 0.23
29 0.29
30 0.33
31 0.33
32 0.32
33 0.31
34 0.3
35 0.33
36 0.33
37 0.27
38 0.21
39 0.19
40 0.17
41 0.17
42 0.16
43 0.11
44 0.09
45 0.1
46 0.11
47 0.11
48 0.13
49 0.13
50 0.13
51 0.16
52 0.16
53 0.13
54 0.15
55 0.17
56 0.17
57 0.18
58 0.19
59 0.16
60 0.15
61 0.16
62 0.15
63 0.12
64 0.11
65 0.13
66 0.12
67 0.13
68 0.13
69 0.11
70 0.1
71 0.1
72 0.1
73 0.08
74 0.08
75 0.06
76 0.06
77 0.06
78 0.06
79 0.05
80 0.05
81 0.05
82 0.09
83 0.1
84 0.1
85 0.11
86 0.11
87 0.12
88 0.22
89 0.31
90 0.38
91 0.48
92 0.57
93 0.64
94 0.72
95 0.8
96 0.8
97 0.79
98 0.8
99 0.79
100 0.78
101 0.79
102 0.79
103 0.74
104 0.67
105 0.57
106 0.47
107 0.37
108 0.28
109 0.2
110 0.13
111 0.09
112 0.07
113 0.07
114 0.07
115 0.09
116 0.11
117 0.14
118 0.15
119 0.16
120 0.18
121 0.19
122 0.23
123 0.26
124 0.25
125 0.25
126 0.28
127 0.28
128 0.26
129 0.24
130 0.19
131 0.14
132 0.14
133 0.11
134 0.08
135 0.08
136 0.12
137 0.14
138 0.18
139 0.2
140 0.21