Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094AAY9

Protein Details
Accession A0A094AAY9    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
179-199SEPPAKRGRGRPPKNKAPVANHydrophilic
NLS Segment(s)
PositionSequence
130-136ARKRGRP
162-195KRKSIGEPSGGEAPAPGSEPPAKRGRGRPPKNKA
Subcellular Location(s) cyto_nucl 14.5, cyto 13, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MAVGPFTECEQRFLLAEILKTSNIPIDALLGVLRDQNFDPNWEDVGLPAGRNVKNCAAELAHLNSSLGGDSNPDSTKQTSRGIKRTLSASAFYGPATPATKTREIKPKPAAASNGADKPAAASTPATGSARKRGRPSNAELAQRAKEASERGEAQQATPATKRKSIGEPSGGEAPAPGSEPPAKRGRGRPPKNKAPVANPDVEERKPSEEGADAAVPTVPETETEPEVNDGTTPDDAASKETRESLEVVARAASASEALAPESHDAPPNPQTSTFKKLFGLGSQPATTQAPPLEQATRAAAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.21
3 0.22
4 0.22
5 0.23
6 0.22
7 0.21
8 0.2
9 0.18
10 0.16
11 0.15
12 0.12
13 0.12
14 0.11
15 0.11
16 0.11
17 0.08
18 0.08
19 0.11
20 0.11
21 0.12
22 0.12
23 0.17
24 0.18
25 0.2
26 0.22
27 0.21
28 0.22
29 0.2
30 0.2
31 0.14
32 0.19
33 0.17
34 0.13
35 0.14
36 0.2
37 0.21
38 0.23
39 0.27
40 0.28
41 0.29
42 0.3
43 0.29
44 0.23
45 0.23
46 0.25
47 0.25
48 0.21
49 0.18
50 0.18
51 0.15
52 0.15
53 0.13
54 0.1
55 0.06
56 0.06
57 0.07
58 0.11
59 0.11
60 0.12
61 0.15
62 0.17
63 0.21
64 0.23
65 0.29
66 0.34
67 0.41
68 0.47
69 0.49
70 0.49
71 0.48
72 0.47
73 0.45
74 0.38
75 0.32
76 0.26
77 0.23
78 0.22
79 0.19
80 0.17
81 0.12
82 0.13
83 0.13
84 0.12
85 0.14
86 0.19
87 0.26
88 0.27
89 0.34
90 0.42
91 0.44
92 0.51
93 0.54
94 0.55
95 0.5
96 0.52
97 0.48
98 0.41
99 0.41
100 0.37
101 0.33
102 0.28
103 0.24
104 0.2
105 0.19
106 0.15
107 0.12
108 0.09
109 0.06
110 0.06
111 0.07
112 0.09
113 0.09
114 0.1
115 0.12
116 0.2
117 0.25
118 0.29
119 0.32
120 0.37
121 0.43
122 0.46
123 0.5
124 0.52
125 0.52
126 0.51
127 0.48
128 0.45
129 0.39
130 0.35
131 0.29
132 0.19
133 0.15
134 0.13
135 0.13
136 0.13
137 0.13
138 0.13
139 0.18
140 0.18
141 0.16
142 0.19
143 0.18
144 0.17
145 0.18
146 0.22
147 0.2
148 0.23
149 0.24
150 0.23
151 0.28
152 0.31
153 0.33
154 0.32
155 0.31
156 0.31
157 0.33
158 0.3
159 0.23
160 0.19
161 0.15
162 0.1
163 0.1
164 0.08
165 0.07
166 0.12
167 0.13
168 0.17
169 0.23
170 0.25
171 0.29
172 0.36
173 0.45
174 0.52
175 0.61
176 0.67
177 0.71
178 0.79
179 0.83
180 0.82
181 0.74
182 0.7
183 0.69
184 0.63
185 0.58
186 0.49
187 0.45
188 0.42
189 0.39
190 0.34
191 0.27
192 0.25
193 0.22
194 0.22
195 0.18
196 0.16
197 0.16
198 0.16
199 0.15
200 0.11
201 0.11
202 0.11
203 0.1
204 0.09
205 0.09
206 0.06
207 0.06
208 0.08
209 0.11
210 0.12
211 0.13
212 0.13
213 0.14
214 0.14
215 0.14
216 0.12
217 0.1
218 0.1
219 0.1
220 0.09
221 0.08
222 0.09
223 0.1
224 0.13
225 0.14
226 0.14
227 0.15
228 0.16
229 0.17
230 0.17
231 0.18
232 0.17
233 0.2
234 0.19
235 0.18
236 0.16
237 0.16
238 0.14
239 0.13
240 0.1
241 0.06
242 0.05
243 0.06
244 0.06
245 0.07
246 0.07
247 0.08
248 0.1
249 0.12
250 0.13
251 0.16
252 0.16
253 0.2
254 0.27
255 0.28
256 0.28
257 0.3
258 0.35
259 0.37
260 0.44
261 0.42
262 0.38
263 0.37
264 0.39
265 0.37
266 0.35
267 0.36
268 0.32
269 0.34
270 0.33
271 0.32
272 0.31
273 0.31
274 0.27
275 0.24
276 0.21
277 0.19
278 0.2
279 0.23
280 0.23
281 0.22
282 0.24