Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094A4R2

Protein Details
Accession A0A094A4R2   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
28-48CSEKHKCPGKHECPQKHKCLEBasic
NLS Segment(s)
PositionSequence
54-124KKPKHPTLELGKSHYDRPKTGMKKVKPAEIKVKEKNGKVKVKVKDGHAKIRVKGKDGKMKVKIKDKAGKIK
Subcellular Location(s) nucl 11.5, cyto_nucl 11.333, mito_nucl 9.166, cyto 9, mito 5.5
Family & Domain DBs
Amino Acid Sequences EFERRMKGEVLGSIVEEYTSWEKEEDECSEKHKCPGKHECPQKHKCLEDAREAKKPKHPTLELGKSHYDRPKTGMKKVKPAEIKVKEKNGKVKVKVKDGHAKIRVKGKDGKMKVKIKDKAGKIKVESG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.1
4 0.13
5 0.13
6 0.13
7 0.14
8 0.13
9 0.14
10 0.16
11 0.19
12 0.2
13 0.2
14 0.2
15 0.23
16 0.29
17 0.3
18 0.35
19 0.4
20 0.38
21 0.43
22 0.54
23 0.59
24 0.62
25 0.71
26 0.74
27 0.76
28 0.81
29 0.81
30 0.76
31 0.68
32 0.65
33 0.63
34 0.57
35 0.56
36 0.57
37 0.53
38 0.55
39 0.57
40 0.54
41 0.53
42 0.56
43 0.51
44 0.5
45 0.47
46 0.45
47 0.51
48 0.57
49 0.51
50 0.47
51 0.46
52 0.39
53 0.43
54 0.41
55 0.34
56 0.26
57 0.28
58 0.34
59 0.34
60 0.41
61 0.46
62 0.45
63 0.53
64 0.54
65 0.58
66 0.54
67 0.55
68 0.57
69 0.57
70 0.62
71 0.58
72 0.66
73 0.64
74 0.63
75 0.68
76 0.66
77 0.66
78 0.65
79 0.68
80 0.64
81 0.68
82 0.67
83 0.65
84 0.66
85 0.63
86 0.65
87 0.65
88 0.64
89 0.59
90 0.64
91 0.59
92 0.54
93 0.57
94 0.56
95 0.58
96 0.6
97 0.66
98 0.66
99 0.72
100 0.75
101 0.77
102 0.75
103 0.74
104 0.76
105 0.75
106 0.76
107 0.75
108 0.75