Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094B5Z5

Protein Details
Accession A0A094B5Z5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
66-91LQAANEQKKRRERKCKRRIMQGGSLSHydrophilic
NLS Segment(s)
PositionSequence
73-83KKRRERKCKRR
Subcellular Location(s) nucl 20.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences ESDNWTSKTPQTIRELDFQTEHVKNCIIQHQNSSPSSINDALSRLAKGAQVMMYSAVLLKAEVKALQAANEQKKRRERKCKRRIMQGGSLSVREGEDIVQSAEVEAQVRTEVASESSRQVGSKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.45
4 0.43
5 0.38
6 0.38
7 0.35
8 0.33
9 0.27
10 0.25
11 0.23
12 0.25
13 0.31
14 0.29
15 0.27
16 0.32
17 0.35
18 0.4
19 0.39
20 0.4
21 0.34
22 0.3
23 0.32
24 0.27
25 0.23
26 0.18
27 0.18
28 0.16
29 0.16
30 0.15
31 0.11
32 0.11
33 0.1
34 0.09
35 0.09
36 0.08
37 0.07
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.06
52 0.06
53 0.07
54 0.1
55 0.16
56 0.24
57 0.31
58 0.33
59 0.38
60 0.47
61 0.57
62 0.63
63 0.69
64 0.73
65 0.77
66 0.86
67 0.9
68 0.88
69 0.89
70 0.89
71 0.84
72 0.82
73 0.76
74 0.71
75 0.62
76 0.55
77 0.44
78 0.35
79 0.28
80 0.19
81 0.14
82 0.08
83 0.07
84 0.07
85 0.08
86 0.08
87 0.07
88 0.07
89 0.08
90 0.07
91 0.07
92 0.06
93 0.06
94 0.06
95 0.07
96 0.06
97 0.07
98 0.07
99 0.09
100 0.11
101 0.13
102 0.15
103 0.18
104 0.19