Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093ZSM1

Protein Details
Accession A0A093ZSM1   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
75-110MWAISVKRQRKLKMKKHKYKKLMRRTRNLRRRLDRNBasic
NLS Segment(s)
PositionSequence
81-110KRQRKLKMKKHKYKKLMRRTRNLRRRLDRN
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MPVDAAPAAETAQAKRTYTATLTIEESTSPLGEVTYVARSSPLQDVAEPTVPTAFRERMRERRQRYVEERAGGEMWAISVKRQRKLKMKKHKYKKLMRRTRNLRRRLDRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.22
4 0.22
5 0.22
6 0.26
7 0.22
8 0.21
9 0.23
10 0.22
11 0.21
12 0.18
13 0.17
14 0.12
15 0.11
16 0.09
17 0.06
18 0.05
19 0.05
20 0.06
21 0.07
22 0.08
23 0.08
24 0.08
25 0.09
26 0.09
27 0.11
28 0.13
29 0.14
30 0.11
31 0.12
32 0.14
33 0.15
34 0.18
35 0.16
36 0.14
37 0.13
38 0.12
39 0.13
40 0.14
41 0.15
42 0.14
43 0.22
44 0.27
45 0.36
46 0.45
47 0.53
48 0.56
49 0.63
50 0.66
51 0.67
52 0.67
53 0.67
54 0.62
55 0.56
56 0.51
57 0.42
58 0.38
59 0.3
60 0.24
61 0.14
62 0.09
63 0.08
64 0.08
65 0.08
66 0.14
67 0.19
68 0.26
69 0.33
70 0.41
71 0.49
72 0.61
73 0.7
74 0.75
75 0.82
76 0.86
77 0.91
78 0.94
79 0.94
80 0.94
81 0.94
82 0.93
83 0.93
84 0.92
85 0.92
86 0.93
87 0.93
88 0.92
89 0.91
90 0.91