Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4JG64

Protein Details
Accession C4JG64    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
35-69KTQDSKKIKTHAKNMKNKKRFRHRQDSNLRLRRDWBasic
NLS Segment(s)
PositionSequence
39-58SKKIKTHAKNMKNKKRFRHR
Subcellular Location(s) nucl 18, mito 5, cyto 2, plas 2
Family & Domain DBs
KEGG ure:UREG_02462  -  
Amino Acid Sequences MCQVYSRNSDGNPARLQAFIHFDCQGVGDRPQGPKTQDSKKIKTHAKNMKNKKRFRHRQDSNLRLRRDWIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.29
4 0.23
5 0.25
6 0.2
7 0.21
8 0.2
9 0.19
10 0.18
11 0.18
12 0.17
13 0.13
14 0.13
15 0.14
16 0.16
17 0.18
18 0.2
19 0.22
20 0.22
21 0.26
22 0.3
23 0.35
24 0.42
25 0.47
26 0.51
27 0.55
28 0.61
29 0.64
30 0.65
31 0.68
32 0.69
33 0.71
34 0.76
35 0.81
36 0.83
37 0.85
38 0.85
39 0.86
40 0.87
41 0.88
42 0.88
43 0.88
44 0.86
45 0.88
46 0.91
47 0.91
48 0.91
49 0.88
50 0.82
51 0.72