Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JWG0

Protein Details
Accession C4JWG0   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MKRQPRKLKWTKTHRALRGKEMIBasic
NLS Segment(s)
PositionSequence
64-87RRERVFTKRRLAGKIARDRKRAED
Subcellular Location(s) mito 18.5, cyto_mito 10.333, nucl 7.5, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000988  Ribosomal_L24e-rel  
KEGG ure:UREG_06902  -  
Amino Acid Sequences MKRQPRKLKWTKTHRALRGKEMIVDSSLVLSQFAKKRNIPVKYDRNLVAATVKAMERVEEIRQRRERVFTKRRLAGKIARDRKRAEDRRVVAEGEHLIRKELQMLEKGVPLEEQRNKNAAVVGQERVRQKKKTRMLVDGGTQEEMDID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.83
4 0.81
5 0.79
6 0.69
7 0.63
8 0.55
9 0.47
10 0.37
11 0.33
12 0.24
13 0.16
14 0.15
15 0.11
16 0.09
17 0.08
18 0.14
19 0.18
20 0.23
21 0.27
22 0.28
23 0.37
24 0.45
25 0.5
26 0.51
27 0.56
28 0.61
29 0.6
30 0.63
31 0.55
32 0.49
33 0.43
34 0.38
35 0.29
36 0.2
37 0.16
38 0.13
39 0.11
40 0.1
41 0.1
42 0.09
43 0.09
44 0.11
45 0.14
46 0.19
47 0.22
48 0.3
49 0.35
50 0.38
51 0.38
52 0.43
53 0.45
54 0.49
55 0.56
56 0.56
57 0.58
58 0.62
59 0.64
60 0.6
61 0.57
62 0.53
63 0.53
64 0.54
65 0.57
66 0.57
67 0.57
68 0.57
69 0.61
70 0.65
71 0.64
72 0.61
73 0.6
74 0.57
75 0.58
76 0.57
77 0.5
78 0.39
79 0.32
80 0.28
81 0.21
82 0.2
83 0.15
84 0.14
85 0.14
86 0.14
87 0.16
88 0.15
89 0.15
90 0.16
91 0.19
92 0.19
93 0.21
94 0.21
95 0.17
96 0.17
97 0.16
98 0.21
99 0.26
100 0.29
101 0.3
102 0.33
103 0.33
104 0.33
105 0.33
106 0.27
107 0.25
108 0.24
109 0.24
110 0.25
111 0.3
112 0.35
113 0.43
114 0.48
115 0.51
116 0.57
117 0.64
118 0.7
119 0.76
120 0.76
121 0.74
122 0.74
123 0.71
124 0.68
125 0.63
126 0.55
127 0.45
128 0.39