Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094C8K8

Protein Details
Accession A0A094C8K8    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
56-86TPQHPRRRSAPPLRRPHKRRHHQVPPRIDQLBasic
90-114TTAQVQSRHRRQPRQLLRPERAQRGHydrophilic
NLS Segment(s)
PositionSequence
53-77FPPTPQHPRRRSAPPLRRPHKRRHH
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 5
Family & Domain DBs
Amino Acid Sequences MGPPIPPRKPPSVSIGSYNRIPPRGPPQPARPPFPPTQAQASHSRRLHQRHAFPPTPQHPRRRSAPPLRRPHKRRHHQVPPRIDQLAQHTTAQVQSRHRRQPRQLLRPERAQRGGHQLQDSPGLGKHHIPAQPLHAPAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.53
3 0.49
4 0.48
5 0.51
6 0.47
7 0.41
8 0.39
9 0.36
10 0.4
11 0.45
12 0.49
13 0.49
14 0.54
15 0.63
16 0.68
17 0.69
18 0.63
19 0.61
20 0.58
21 0.57
22 0.52
23 0.44
24 0.46
25 0.42
26 0.41
27 0.45
28 0.46
29 0.49
30 0.46
31 0.48
32 0.48
33 0.51
34 0.57
35 0.55
36 0.58
37 0.56
38 0.64
39 0.61
40 0.55
41 0.58
42 0.56
43 0.59
44 0.56
45 0.59
46 0.55
47 0.58
48 0.62
49 0.61
50 0.63
51 0.64
52 0.68
53 0.69
54 0.75
55 0.77
56 0.82
57 0.79
58 0.8
59 0.8
60 0.8
61 0.8
62 0.8
63 0.84
64 0.83
65 0.87
66 0.85
67 0.8
68 0.74
69 0.64
70 0.54
71 0.45
72 0.42
73 0.37
74 0.29
75 0.24
76 0.2
77 0.19
78 0.22
79 0.24
80 0.21
81 0.26
82 0.33
83 0.42
84 0.52
85 0.59
86 0.65
87 0.7
88 0.77
89 0.8
90 0.81
91 0.82
92 0.82
93 0.79
94 0.81
95 0.8
96 0.77
97 0.72
98 0.64
99 0.58
100 0.58
101 0.57
102 0.52
103 0.47
104 0.41
105 0.36
106 0.38
107 0.35
108 0.27
109 0.25
110 0.23
111 0.22
112 0.22
113 0.23
114 0.25
115 0.27
116 0.28
117 0.27
118 0.31
119 0.35