Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094AEX2

Protein Details
Accession A0A094AEX2    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-70HQHNSDKMRAKWRKKRTRRLKRKRRKTRARSKBasic
NLS Segment(s)
PositionSequence
45-70KMRAKWRKKRTRRLKRKRRKTRARSK
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MEHFRWARPIACQFGASETLNYQPSLLTTTSSLLHHQLHQHNSDKMRAKWRKKRTRRLKRKRRKTRARSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.26
4 0.21
5 0.16
6 0.18
7 0.18
8 0.17
9 0.15
10 0.11
11 0.1
12 0.12
13 0.11
14 0.09
15 0.08
16 0.1
17 0.11
18 0.12
19 0.12
20 0.12
21 0.13
22 0.14
23 0.19
24 0.22
25 0.24
26 0.27
27 0.3
28 0.32
29 0.32
30 0.38
31 0.39
32 0.38
33 0.46
34 0.52
35 0.58
36 0.65
37 0.74
38 0.79
39 0.84
40 0.91
41 0.92
42 0.94
43 0.95
44 0.96
45 0.96
46 0.97
47 0.97
48 0.98
49 0.97
50 0.97