Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093ZPS4

Protein Details
Accession A0A093ZPS4   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-45QKANEALSKRRRAKKTRVRQGGAHydrophilic
NLS Segment(s)
PositionSequence
31-40KRRRAKKTRV
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MAKGIEAMAHEMTLMKEENHNLQKANEALSKRRRAKKTRVRQGGALTVDNAQDILAQKEVNEQVAQDIRGNQGSDRERLATIRRCGNCSKPGHNARTCQMEAEMSDVYSSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.09
3 0.12
4 0.14
5 0.23
6 0.27
7 0.29
8 0.28
9 0.27
10 0.31
11 0.29
12 0.31
13 0.27
14 0.25
15 0.31
16 0.39
17 0.49
18 0.53
19 0.62
20 0.67
21 0.71
22 0.79
23 0.82
24 0.84
25 0.85
26 0.86
27 0.79
28 0.74
29 0.7
30 0.65
31 0.56
32 0.45
33 0.35
34 0.25
35 0.22
36 0.18
37 0.14
38 0.08
39 0.07
40 0.07
41 0.07
42 0.06
43 0.06
44 0.06
45 0.09
46 0.1
47 0.1
48 0.09
49 0.08
50 0.1
51 0.11
52 0.12
53 0.1
54 0.11
55 0.11
56 0.13
57 0.13
58 0.12
59 0.17
60 0.19
61 0.19
62 0.2
63 0.2
64 0.19
65 0.21
66 0.28
67 0.29
68 0.31
69 0.38
70 0.39
71 0.41
72 0.45
73 0.49
74 0.51
75 0.49
76 0.5
77 0.52
78 0.59
79 0.64
80 0.65
81 0.63
82 0.6
83 0.61
84 0.56
85 0.47
86 0.4
87 0.32
88 0.28
89 0.26
90 0.22
91 0.14