Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JZ26

Protein Details
Accession C4JZ26    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPKEKTTRQAAKGRRDKKKKDPNAPKRGLSABasic
NLS Segment(s)
PositionSequence
8-27RQAAKGRRDKKKKDPNAPKR
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG ure:UREG_07427  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKTTRQAAKGRRDKKKKDPNAPKRGLSAYMFFANEQRENVREENPGISFGQVGKLLGERWKALSDKQRAPYEEKAAADKKRYEDEKASYNQAPEEDEESALDIGRMKFDLGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.88
5 0.91
6 0.9
7 0.91
8 0.92
9 0.92
10 0.93
11 0.9
12 0.82
13 0.75
14 0.67
15 0.59
16 0.49
17 0.41
18 0.32
19 0.28
20 0.26
21 0.21
22 0.21
23 0.21
24 0.19
25 0.18
26 0.17
27 0.15
28 0.19
29 0.2
30 0.19
31 0.18
32 0.18
33 0.19
34 0.17
35 0.17
36 0.14
37 0.12
38 0.11
39 0.09
40 0.1
41 0.08
42 0.08
43 0.06
44 0.07
45 0.07
46 0.09
47 0.1
48 0.09
49 0.1
50 0.12
51 0.13
52 0.17
53 0.25
54 0.29
55 0.35
56 0.41
57 0.44
58 0.45
59 0.49
60 0.5
61 0.47
62 0.43
63 0.37
64 0.36
65 0.37
66 0.38
67 0.38
68 0.36
69 0.35
70 0.39
71 0.41
72 0.4
73 0.4
74 0.41
75 0.43
76 0.43
77 0.46
78 0.4
79 0.39
80 0.35
81 0.3
82 0.28
83 0.23
84 0.23
85 0.18
86 0.16
87 0.15
88 0.16
89 0.15
90 0.13
91 0.11
92 0.12
93 0.11
94 0.12
95 0.13