Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094AYQ9

Protein Details
Accession A0A094AYQ9    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
22-48KEAEDKPVAKRPRRRPRKRPIEEVDEEBasic
56-81SDSSSSECKRPRRRPRKRPIEEVDEEBasic
NLS Segment(s)
PositionSequence
26-41DKPVAKRPRRRPRKRP
64-74KRPRRRPRKRP
Subcellular Location(s) nucl 20, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MSTKQYYSNGILIKRARGLSYKEAEDKPVAKRPRRRPRKRPIEEVDEEEEEEEVLSDSSSSECKRPRRRPRKRPIEEVDEEEEEEEVLSDSSSSECEGEVIVAKGNLRSTAYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.3
4 0.3
5 0.34
6 0.36
7 0.38
8 0.39
9 0.41
10 0.4
11 0.41
12 0.41
13 0.39
14 0.36
15 0.4
16 0.44
17 0.47
18 0.56
19 0.64
20 0.72
21 0.8
22 0.86
23 0.88
24 0.91
25 0.94
26 0.91
27 0.9
28 0.86
29 0.84
30 0.75
31 0.69
32 0.62
33 0.51
34 0.43
35 0.32
36 0.25
37 0.16
38 0.13
39 0.08
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.04
46 0.06
47 0.06
48 0.1
49 0.16
50 0.26
51 0.37
52 0.48
53 0.59
54 0.69
55 0.8
56 0.87
57 0.93
58 0.95
59 0.92
60 0.91
61 0.87
62 0.84
63 0.76
64 0.69
65 0.62
66 0.51
67 0.43
68 0.32
69 0.25
70 0.16
71 0.13
72 0.08
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.04
80 0.05
81 0.05
82 0.05
83 0.06
84 0.06
85 0.07
86 0.08
87 0.08
88 0.09
89 0.1
90 0.11
91 0.13
92 0.14
93 0.15