Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093ZWS8

Protein Details
Accession A0A093ZWS8   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
16-35DASPRPTPRRSVNKAPRAISHydrophilic
NLS Segment(s)
PositionSequence
54-65AARSRADKGKGR
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027786  Nse4/EID  
IPR029225  Nse4_Nse3-bd  
Gene Ontology GO:0005634  C:nucleus  
GO:0030915  C:Smc5-Smc6 complex  
GO:0006310  P:DNA recombination  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF15412  Nse4-Nse3_bdg  
Amino Acid Sequences MTSRSPAPTYTEDVWDASPRPTPRRSVNKAPRAISPSSSPQSAASLSSDKENKAARSRADKGKGREGMGAPSMSRGLSEISNGRSVKRKAVEVRDVGERSRSVRRRTREPENGSPVSQNGDEERNNNYDPDQDLQERRELRARFRTLEKDLNNNRAEYLHADNEGLKQTLLDADEILNGVKQTGDATVDSRLIANAADLSLKKIEKLTLGDTDRRIDIDHFVAKCMTFMRQGQTSPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.27
4 0.23
5 0.27
6 0.28
7 0.34
8 0.36
9 0.41
10 0.47
11 0.57
12 0.63
13 0.68
14 0.73
15 0.77
16 0.8
17 0.76
18 0.73
19 0.67
20 0.61
21 0.53
22 0.47
23 0.45
24 0.41
25 0.4
26 0.34
27 0.29
28 0.29
29 0.27
30 0.22
31 0.17
32 0.16
33 0.16
34 0.21
35 0.23
36 0.21
37 0.25
38 0.28
39 0.3
40 0.35
41 0.39
42 0.38
43 0.44
44 0.5
45 0.54
46 0.59
47 0.62
48 0.6
49 0.65
50 0.64
51 0.57
52 0.55
53 0.47
54 0.41
55 0.36
56 0.31
57 0.22
58 0.19
59 0.18
60 0.13
61 0.11
62 0.09
63 0.08
64 0.07
65 0.09
66 0.11
67 0.13
68 0.19
69 0.19
70 0.2
71 0.26
72 0.27
73 0.32
74 0.31
75 0.35
76 0.36
77 0.43
78 0.47
79 0.42
80 0.43
81 0.43
82 0.41
83 0.35
84 0.32
85 0.25
86 0.22
87 0.29
88 0.33
89 0.34
90 0.41
91 0.46
92 0.53
93 0.59
94 0.66
95 0.66
96 0.68
97 0.68
98 0.68
99 0.65
100 0.55
101 0.49
102 0.4
103 0.32
104 0.24
105 0.17
106 0.11
107 0.12
108 0.12
109 0.13
110 0.16
111 0.16
112 0.17
113 0.16
114 0.15
115 0.14
116 0.15
117 0.15
118 0.15
119 0.15
120 0.17
121 0.18
122 0.23
123 0.22
124 0.22
125 0.27
126 0.26
127 0.29
128 0.37
129 0.39
130 0.37
131 0.41
132 0.45
133 0.43
134 0.49
135 0.45
136 0.46
137 0.47
138 0.52
139 0.49
140 0.43
141 0.39
142 0.31
143 0.3
144 0.23
145 0.23
146 0.16
147 0.16
148 0.16
149 0.16
150 0.18
151 0.18
152 0.15
153 0.11
154 0.09
155 0.09
156 0.1
157 0.1
158 0.08
159 0.07
160 0.07
161 0.07
162 0.08
163 0.08
164 0.07
165 0.06
166 0.06
167 0.05
168 0.05
169 0.05
170 0.06
171 0.07
172 0.07
173 0.09
174 0.1
175 0.11
176 0.11
177 0.11
178 0.1
179 0.09
180 0.08
181 0.07
182 0.06
183 0.06
184 0.08
185 0.08
186 0.11
187 0.14
188 0.15
189 0.15
190 0.16
191 0.18
192 0.19
193 0.22
194 0.23
195 0.27
196 0.31
197 0.36
198 0.36
199 0.38
200 0.35
201 0.33
202 0.31
203 0.24
204 0.23
205 0.24
206 0.28
207 0.25
208 0.26
209 0.27
210 0.25
211 0.25
212 0.23
213 0.2
214 0.19
215 0.22
216 0.26
217 0.29