FuNGI

C4JX28

Protein Details

Accession

C4JX28

Localization Confidence

High

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
355-383	ADSPSKVQRQWKKKGQKRTTRLVHLRPVR	Hydrophilic

NLS Segment(s)

Position	Sequence
365-383	WKKKGQKRTTRLVHLRPVR
441-483	EKLGGNKLVQKARKIKATAHANYRALKIRSKNGAGKGRFGRRR

Subcellular Location(s)

nucl 25

Family & Domain DBs

InterPro	View protein in InterPro IPR021110 DNA_rep_checkpnt_protein IPR040203 Sld2
Gene Ontology	GO:0005634 C:nucleus GO:0007049 P:cell cycle GO:0006270 P:DNA replication initiation
KEGG	ure:UREG_06201 -
Pfam	View protein in Pfam PF11719 Drc1-Sld2
CDD	cd22289 RecQL4_SLD2_NTD

Amino Acid Sequences

MTANIEKLRAELKEWEKAFAEANGGRKASREDIKNDPSIAAKYKAYARLRSQPSSSSLRANPDNGASPGHSQKKRINPFVDNDKHEHHVFATPRKVAKHTSSTPKHPSQLDSYETTSDIKKLLSPGGPYTSPAPLRTAIGPTPQRDGKVLGLFDLLSPSASSTATPSKRKPFEPADGTHTPSRARGMVTPSRRDGSALRPRRHSLTPASSAKKFFLSKYCATPTTMRFAPITEADDENDDKNADSERIDTLLSEQSPVRQRPEPETPTFLRRRNVLFAQPANHARSKTGAASPVAVRMPQRIFGRGLSQLVRDLHDLGEEMSNAEMEDDMEALREAEATERTNEDRGLVENSQIADSPSKVQRQWKKKGQKRTTRLVHLRPVRAKPQRVPEPVIRDEDSEDELDAVSEPQIPVSAGGDNGVGEDAVNSTRPKGKDSTQNKEKLGGNKLVQKARKIKATAHANYRALKIRSKNGAGKGRFGRRR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.4
2	0.42
3	0.39
4	0.39
5	0.38
6	0.3
7	0.31
8	0.25
9	0.3
10	0.31
11	0.3
12	0.29
13	0.29
14	0.33
15	0.34
16	0.38
17	0.39
18	0.39
19	0.48
20	0.54
21	0.56
22	0.52
23	0.46
24	0.41
25	0.39
26	0.39
27	0.33
28	0.27
29	0.27
30	0.32
31	0.4
32	0.43
33	0.46
34	0.48
35	0.55
36	0.61
37	0.63
38	0.59
39	0.54
40	0.54
41	0.54
42	0.49
43	0.46
44	0.43
45	0.45
46	0.45
47	0.43
48	0.4
49	0.35
50	0.37
51	0.3
52	0.29
53	0.24
54	0.25
55	0.32
56	0.4
57	0.4
58	0.41
59	0.48
60	0.57
61	0.64
62	0.68
63	0.66
64	0.62
65	0.66
66	0.72
67	0.72
68	0.66
69	0.61
70	0.56
71	0.54
72	0.49
73	0.42
74	0.33
75	0.32
76	0.32
77	0.35
78	0.38
79	0.38
80	0.41
81	0.43
82	0.44
83	0.43
84	0.45
85	0.47
86	0.48
87	0.55
88	0.58
89	0.63
90	0.69
91	0.68
92	0.67
93	0.6
94	0.56
95	0.52
96	0.5
97	0.46
98	0.41
99	0.37
100	0.33
101	0.31
102	0.29
103	0.24
104	0.2
105	0.17
106	0.14
107	0.13
108	0.14
109	0.17
110	0.18
111	0.19
112	0.21
113	0.24
114	0.24
115	0.24
116	0.24
117	0.25
118	0.24
119	0.23
120	0.22
121	0.19
122	0.21
123	0.21
124	0.22
125	0.18
126	0.24
127	0.28
128	0.27
129	0.32
130	0.32
131	0.31
132	0.29
133	0.3
134	0.26
135	0.26
136	0.24
137	0.19
138	0.18
139	0.17
140	0.16
141	0.14
142	0.1
143	0.06
144	0.06
145	0.06
146	0.06
147	0.06
148	0.06
149	0.08
150	0.17
151	0.22
152	0.27
153	0.32
154	0.41
155	0.45
156	0.47
157	0.51
158	0.49
159	0.52
160	0.52
161	0.5
162	0.48
163	0.46
164	0.48
165	0.43
166	0.38
167	0.3
168	0.25
169	0.25
170	0.18
171	0.17
172	0.16
173	0.21
174	0.28
175	0.33
176	0.36
177	0.37
178	0.36
179	0.35
180	0.34
181	0.29
182	0.31
183	0.36
184	0.41
185	0.43
186	0.46
187	0.48
188	0.51
189	0.51
190	0.45
191	0.41
192	0.38
193	0.42
194	0.44
195	0.46
196	0.44
197	0.43
198	0.4
199	0.38
200	0.32
201	0.26
202	0.26
203	0.28
204	0.28
205	0.32
206	0.34
207	0.31
208	0.32
209	0.34
210	0.29
211	0.29
212	0.27
213	0.23
214	0.2
215	0.2
216	0.19
217	0.16
218	0.17
219	0.13
220	0.12
221	0.11
222	0.13
223	0.13
224	0.12
225	0.11
226	0.09
227	0.07
228	0.08
229	0.08
230	0.07
231	0.06
232	0.07
233	0.07
234	0.08
235	0.08
236	0.07
237	0.08
238	0.1
239	0.1
240	0.1
241	0.09
242	0.13
243	0.19
244	0.21
245	0.23
246	0.24
247	0.26
248	0.3
249	0.39
250	0.4
251	0.36
252	0.4
253	0.39
254	0.43
255	0.47
256	0.46
257	0.4
258	0.38
259	0.38
260	0.38
261	0.39
262	0.35
263	0.34
264	0.32
265	0.32
266	0.33
267	0.34
268	0.33
269	0.32
270	0.28
271	0.24
272	0.24
273	0.23
274	0.21
275	0.19
276	0.18
277	0.16
278	0.18
279	0.18
280	0.19
281	0.17
282	0.16
283	0.15
284	0.16
285	0.17
286	0.2
287	0.21
288	0.2
289	0.21
290	0.21
291	0.24
292	0.21
293	0.23
294	0.19
295	0.18
296	0.19
297	0.19
298	0.2
299	0.17
300	0.16
301	0.14
302	0.13
303	0.13
304	0.1
305	0.1
306	0.08
307	0.08
308	0.07
309	0.07
310	0.06
311	0.06
312	0.05
313	0.04
314	0.04
315	0.04
316	0.04
317	0.04
318	0.04
319	0.04
320	0.04
321	0.04
322	0.04
323	0.06
324	0.08
325	0.09
326	0.1
327	0.12
328	0.14
329	0.15
330	0.15
331	0.14
332	0.14
333	0.14
334	0.17
335	0.16
336	0.15
337	0.16
338	0.16
339	0.16
340	0.15
341	0.15
342	0.11
343	0.12
344	0.16
345	0.19
346	0.23
347	0.26
348	0.35
349	0.43
350	0.52
351	0.61
352	0.67
353	0.73
354	0.77
355	0.86
356	0.87
357	0.88
358	0.86
359	0.87
360	0.85
361	0.85
362	0.86
363	0.82
364	0.81
365	0.78
366	0.79
367	0.75
368	0.72
369	0.72
370	0.72
371	0.71
372	0.69
373	0.71
374	0.72
375	0.7
376	0.7
377	0.67
378	0.66
379	0.63
380	0.61
381	0.52
382	0.43
383	0.4
384	0.36
385	0.31
386	0.23
387	0.2
388	0.15
389	0.13
390	0.12
391	0.11
392	0.09
393	0.07
394	0.09
395	0.08
396	0.08
397	0.09
398	0.09
399	0.09
400	0.09
401	0.1
402	0.08
403	0.08
404	0.08
405	0.08
406	0.08
407	0.07
408	0.06
409	0.05
410	0.05
411	0.06
412	0.06
413	0.09
414	0.09
415	0.13
416	0.19
417	0.21
418	0.24
419	0.28
420	0.34
421	0.43
422	0.51
423	0.59
424	0.63
425	0.7
426	0.67
427	0.69
428	0.68
429	0.65
430	0.62
431	0.59
432	0.55
433	0.55
434	0.61
435	0.63
436	0.62
437	0.63
438	0.66
439	0.65
440	0.68
441	0.62
442	0.61
443	0.62
444	0.68
445	0.67
446	0.66
447	0.68
448	0.64
449	0.65
450	0.64
451	0.63
452	0.55
453	0.56
454	0.53
455	0.54
456	0.58
457	0.63
458	0.65
459	0.66
460	0.73
461	0.67
462	0.7
463	0.7

C4JX28

3D AlphaFold-predicted Structure Viewer