Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JX28

Protein Details
Accession C4JX28    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
355-383ADSPSKVQRQWKKKGQKRTTRLVHLRPVRHydrophilic
NLS Segment(s)
PositionSequence
365-383WKKKGQKRTTRLVHLRPVR
441-483EKLGGNKLVQKARKIKATAHANYRALKIRSKNGAGKGRFGRRR
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR021110  DNA_rep_checkpnt_protein  
IPR040203  Sld2  
Gene Ontology GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0006270  P:DNA replication initiation  
KEGG ure:UREG_06201  -  
Pfam View protein in Pfam  
PF11719  Drc1-Sld2  
CDD cd22289  RecQL4_SLD2_NTD  
Amino Acid Sequences MTANIEKLRAELKEWEKAFAEANGGRKASREDIKNDPSIAAKYKAYARLRSQPSSSSLRANPDNGASPGHSQKKRINPFVDNDKHEHHVFATPRKVAKHTSSTPKHPSQLDSYETTSDIKKLLSPGGPYTSPAPLRTAIGPTPQRDGKVLGLFDLLSPSASSTATPSKRKPFEPADGTHTPSRARGMVTPSRRDGSALRPRRHSLTPASSAKKFFLSKYCATPTTMRFAPITEADDENDDKNADSERIDTLLSEQSPVRQRPEPETPTFLRRRNVLFAQPANHARSKTGAASPVAVRMPQRIFGRGLSQLVRDLHDLGEEMSNAEMEDDMEALREAEATERTNEDRGLVENSQIADSPSKVQRQWKKKGQKRTTRLVHLRPVRAKPQRVPEPVIRDEDSEDELDAVSEPQIPVSAGGDNGVGEDAVNSTRPKGKDSTQNKEKLGGNKLVQKARKIKATAHANYRALKIRSKNGAGKGRFGRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.39
4 0.39
5 0.38
6 0.3
7 0.31
8 0.25
9 0.3
10 0.31
11 0.3
12 0.29
13 0.29
14 0.33
15 0.34
16 0.38
17 0.39
18 0.39
19 0.48
20 0.54
21 0.56
22 0.52
23 0.46
24 0.41
25 0.39
26 0.39
27 0.33
28 0.27
29 0.27
30 0.32
31 0.4
32 0.43
33 0.46
34 0.48
35 0.55
36 0.61
37 0.63
38 0.59
39 0.54
40 0.54
41 0.54
42 0.49
43 0.46
44 0.43
45 0.45
46 0.45
47 0.43
48 0.4
49 0.35
50 0.37
51 0.3
52 0.29
53 0.24
54 0.25
55 0.32
56 0.4
57 0.4
58 0.41
59 0.48
60 0.57
61 0.64
62 0.68
63 0.66
64 0.62
65 0.66
66 0.72
67 0.72
68 0.66
69 0.61
70 0.56
71 0.54
72 0.49
73 0.42
74 0.33
75 0.32
76 0.32
77 0.35
78 0.38
79 0.38
80 0.41
81 0.43
82 0.44
83 0.43
84 0.45
85 0.47
86 0.48
87 0.55
88 0.58
89 0.63
90 0.69
91 0.68
92 0.67
93 0.6
94 0.56
95 0.52
96 0.5
97 0.46
98 0.41
99 0.37
100 0.33
101 0.31
102 0.29
103 0.24
104 0.2
105 0.17
106 0.14
107 0.13
108 0.14
109 0.17
110 0.18
111 0.19
112 0.21
113 0.24
114 0.24
115 0.24
116 0.24
117 0.25
118 0.24
119 0.23
120 0.22
121 0.19
122 0.21
123 0.21
124 0.22
125 0.18
126 0.24
127 0.28
128 0.27
129 0.32
130 0.32
131 0.31
132 0.29
133 0.3
134 0.26
135 0.26
136 0.24
137 0.19
138 0.18
139 0.17
140 0.16
141 0.14
142 0.1
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.06
149 0.08
150 0.17
151 0.22
152 0.27
153 0.32
154 0.41
155 0.45
156 0.47
157 0.51
158 0.49
159 0.52
160 0.52
161 0.5
162 0.48
163 0.46
164 0.48
165 0.43
166 0.38
167 0.3
168 0.25
169 0.25
170 0.18
171 0.17
172 0.16
173 0.21
174 0.28
175 0.33
176 0.36
177 0.37
178 0.36
179 0.35
180 0.34
181 0.29
182 0.31
183 0.36
184 0.41
185 0.43
186 0.46
187 0.48
188 0.51
189 0.51
190 0.45
191 0.41
192 0.38
193 0.42
194 0.44
195 0.46
196 0.44
197 0.43
198 0.4
199 0.38
200 0.32
201 0.26
202 0.26
203 0.28
204 0.28
205 0.32
206 0.34
207 0.31
208 0.32
209 0.34
210 0.29
211 0.29
212 0.27
213 0.23
214 0.2
215 0.2
216 0.19
217 0.16
218 0.17
219 0.13
220 0.12
221 0.11
222 0.13
223 0.13
224 0.12
225 0.11
226 0.09
227 0.07
228 0.08
229 0.08
230 0.07
231 0.06
232 0.07
233 0.07
234 0.08
235 0.08
236 0.07
237 0.08
238 0.1
239 0.1
240 0.1
241 0.09
242 0.13
243 0.19
244 0.21
245 0.23
246 0.24
247 0.26
248 0.3
249 0.39
250 0.4
251 0.36
252 0.4
253 0.39
254 0.43
255 0.47
256 0.46
257 0.4
258 0.38
259 0.38
260 0.38
261 0.39
262 0.35
263 0.34
264 0.32
265 0.32
266 0.33
267 0.34
268 0.33
269 0.32
270 0.28
271 0.24
272 0.24
273 0.23
274 0.21
275 0.19
276 0.18
277 0.16
278 0.18
279 0.18
280 0.19
281 0.17
282 0.16
283 0.15
284 0.16
285 0.17
286 0.2
287 0.21
288 0.2
289 0.21
290 0.21
291 0.24
292 0.21
293 0.23
294 0.19
295 0.18
296 0.19
297 0.19
298 0.2
299 0.17
300 0.16
301 0.14
302 0.13
303 0.13
304 0.1
305 0.1
306 0.08
307 0.08
308 0.07
309 0.07
310 0.06
311 0.06
312 0.05
313 0.04
314 0.04
315 0.04
316 0.04
317 0.04
318 0.04
319 0.04
320 0.04
321 0.04
322 0.04
323 0.06
324 0.08
325 0.09
326 0.1
327 0.12
328 0.14
329 0.15
330 0.15
331 0.14
332 0.14
333 0.14
334 0.17
335 0.16
336 0.15
337 0.16
338 0.16
339 0.16
340 0.15
341 0.15
342 0.11
343 0.12
344 0.16
345 0.19
346 0.23
347 0.26
348 0.35
349 0.43
350 0.52
351 0.61
352 0.67
353 0.73
354 0.77
355 0.86
356 0.87
357 0.88
358 0.86
359 0.87
360 0.85
361 0.85
362 0.86
363 0.82
364 0.81
365 0.78
366 0.79
367 0.75
368 0.72
369 0.72
370 0.72
371 0.71
372 0.69
373 0.71
374 0.72
375 0.7
376 0.7
377 0.67
378 0.66
379 0.63
380 0.61
381 0.52
382 0.43
383 0.4
384 0.36
385 0.31
386 0.23
387 0.2
388 0.15
389 0.13
390 0.12
391 0.11
392 0.09
393 0.07
394 0.09
395 0.08
396 0.08
397 0.09
398 0.09
399 0.09
400 0.09
401 0.1
402 0.08
403 0.08
404 0.08
405 0.08
406 0.08
407 0.07
408 0.06
409 0.05
410 0.05
411 0.06
412 0.06
413 0.09
414 0.09
415 0.13
416 0.19
417 0.21
418 0.24
419 0.28
420 0.34
421 0.43
422 0.51
423 0.59
424 0.63
425 0.7
426 0.67
427 0.69
428 0.68
429 0.65
430 0.62
431 0.59
432 0.55
433 0.55
434 0.61
435 0.63
436 0.62
437 0.63
438 0.66
439 0.65
440 0.68
441 0.62
442 0.61
443 0.62
444 0.68
445 0.67
446 0.66
447 0.68
448 0.64
449 0.65
450 0.64
451 0.63
452 0.55
453 0.56
454 0.53
455 0.54
456 0.58
457 0.63
458 0.65
459 0.66
460 0.73
461 0.67
462 0.7
463 0.7