Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094AFV1

Protein Details
Accession A0A094AFV1    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-29HPRPGGMPSKARNRKRKIEADEAGBasic
NLS Segment(s)
PositionSequence
13-22PSKARNRKRK
Subcellular Location(s) mito 20, cyto 4, nucl 2
Family & Domain DBs
Amino Acid Sequences MSLILHPRPGGMPSKARNRKRKIEADEAGEDVEAAGSATIDRSCTYLLPWPSRLPLLPQSVHTNPPKEARGTPVAPLKYPGTLVNPPLLHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.56
3 0.65
4 0.72
5 0.75
6 0.8
7 0.82
8 0.84
9 0.8
10 0.8
11 0.75
12 0.7
13 0.64
14 0.54
15 0.45
16 0.34
17 0.27
18 0.16
19 0.12
20 0.06
21 0.04
22 0.03
23 0.02
24 0.02
25 0.03
26 0.03
27 0.04
28 0.04
29 0.05
30 0.06
31 0.06
32 0.07
33 0.11
34 0.15
35 0.17
36 0.19
37 0.19
38 0.2
39 0.21
40 0.2
41 0.19
42 0.21
43 0.23
44 0.22
45 0.24
46 0.3
47 0.31
48 0.37
49 0.37
50 0.34
51 0.32
52 0.36
53 0.36
54 0.33
55 0.32
56 0.32
57 0.35
58 0.33
59 0.35
60 0.38
61 0.37
62 0.34
63 0.36
64 0.32
65 0.27
66 0.27
67 0.24
68 0.23
69 0.25
70 0.26
71 0.3