Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094D2B2

Protein Details
Accession A0A094D2B2   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
113-135RVLEARKRWWRRRFGMKERPVKDBasic
NLS Segment(s)
PositionSequence
118-127RKRWWRRRFG
177-180GKKR
Subcellular Location(s) cyto_mito 9.166, mito 9, cyto 9, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MPEYLNLTSTTSAKTTTPSSPDKSLTIYRHSKNRVFTFEPASTEPAEYVVTTAKPAAKSCWAPLLYRGPNAVYECGSPIIGSMRRSAFWTRLTLELGDGVAQVEYNRDAKQLRVLEARKRWWRRRFGMKERPVKDMEDVDVSGLVLELVRTCDHALIATFEKKHFGRNTGPGMDGKGKKRPIGALRIYRAAYDRPQTGKVVDIDGENTPEIRLAPRHRAGSNMTGTHTGDIFEEAVVMACWAAIEAEHRIRHTILDILIQIAENAGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.24
4 0.29
5 0.33
6 0.38
7 0.41
8 0.43
9 0.41
10 0.42
11 0.45
12 0.43
13 0.45
14 0.49
15 0.5
16 0.56
17 0.62
18 0.62
19 0.64
20 0.66
21 0.65
22 0.6
23 0.59
24 0.57
25 0.52
26 0.51
27 0.44
28 0.4
29 0.33
30 0.29
31 0.25
32 0.18
33 0.16
34 0.12
35 0.11
36 0.11
37 0.1
38 0.1
39 0.12
40 0.14
41 0.15
42 0.17
43 0.19
44 0.23
45 0.25
46 0.26
47 0.32
48 0.3
49 0.29
50 0.33
51 0.39
52 0.35
53 0.35
54 0.34
55 0.27
56 0.29
57 0.3
58 0.26
59 0.18
60 0.16
61 0.15
62 0.15
63 0.14
64 0.11
65 0.09
66 0.12
67 0.14
68 0.14
69 0.17
70 0.17
71 0.18
72 0.21
73 0.23
74 0.22
75 0.22
76 0.24
77 0.22
78 0.23
79 0.23
80 0.2
81 0.18
82 0.15
83 0.13
84 0.1
85 0.08
86 0.06
87 0.05
88 0.04
89 0.04
90 0.05
91 0.06
92 0.07
93 0.08
94 0.09
95 0.1
96 0.11
97 0.17
98 0.18
99 0.2
100 0.25
101 0.28
102 0.34
103 0.39
104 0.46
105 0.49
106 0.57
107 0.64
108 0.65
109 0.71
110 0.71
111 0.77
112 0.79
113 0.8
114 0.82
115 0.81
116 0.82
117 0.76
118 0.73
119 0.63
120 0.54
121 0.44
122 0.35
123 0.27
124 0.19
125 0.16
126 0.12
127 0.1
128 0.09
129 0.07
130 0.05
131 0.04
132 0.02
133 0.02
134 0.03
135 0.04
136 0.04
137 0.05
138 0.05
139 0.06
140 0.06
141 0.06
142 0.06
143 0.08
144 0.1
145 0.12
146 0.13
147 0.13
148 0.17
149 0.17
150 0.23
151 0.23
152 0.25
153 0.27
154 0.32
155 0.37
156 0.35
157 0.36
158 0.3
159 0.31
160 0.34
161 0.34
162 0.31
163 0.34
164 0.35
165 0.35
166 0.37
167 0.4
168 0.38
169 0.42
170 0.47
171 0.47
172 0.48
173 0.51
174 0.49
175 0.43
176 0.4
177 0.34
178 0.3
179 0.26
180 0.28
181 0.27
182 0.29
183 0.29
184 0.28
185 0.28
186 0.25
187 0.23
188 0.19
189 0.16
190 0.16
191 0.15
192 0.16
193 0.13
194 0.12
195 0.1
196 0.1
197 0.1
198 0.11
199 0.16
200 0.2
201 0.28
202 0.34
203 0.38
204 0.38
205 0.41
206 0.43
207 0.44
208 0.44
209 0.37
210 0.34
211 0.32
212 0.32
213 0.3
214 0.26
215 0.19
216 0.14
217 0.13
218 0.12
219 0.09
220 0.08
221 0.07
222 0.07
223 0.07
224 0.06
225 0.04
226 0.04
227 0.04
228 0.04
229 0.04
230 0.03
231 0.06
232 0.11
233 0.18
234 0.2
235 0.21
236 0.24
237 0.24
238 0.25
239 0.25
240 0.24
241 0.19
242 0.2
243 0.2
244 0.18
245 0.18
246 0.17
247 0.15