Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094AMV7

Protein Details
Accession A0A094AMV7    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
208-230DEAAKKLKAERKSKRKAEKAELLBasic
NLS Segment(s)
PositionSequence
210-240AAKKLKAERKSKRKAEKAELLRLAEIRKKKN
Subcellular Location(s) mito 18.5, mito_nucl 12.666, cyto_mito 11.333, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSGSPTMAGKPPKAMSSRLLTMKFMQRAAASSPLSSPSTPDQPSAKRQKTRADDSPLAGFDVNALANQKAIENALASEEAKRQIALDKQASEAGDTRWVLNFEPNGPEKGPGCGNLKIQQASFSAIDRDSAAMPRVIYQAEETSDNAIFAGRRSFGKFNRKLEKLQDPEGDDSSDSDSDNGSGEQEEAEDSDGDYDDPTSQLMKTARDEAAKKLKAERKSKRKAEKAELLRLAEIRKKKNVKLNNLTSISGSSGASKGTCHKEATQLTSLIQREDIYVLCDEGHALITETVFDCLPALVKSHAAVWLLTAIRRWRGTIDKACKPLVVGVAEGDETAEEWLGLVAFHGFQFGNETISAPTCRLTTLRAEEWQGGMYVANPWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.41
4 0.47
5 0.47
6 0.47
7 0.43
8 0.46
9 0.52
10 0.5
11 0.43
12 0.39
13 0.33
14 0.33
15 0.34
16 0.35
17 0.27
18 0.24
19 0.24
20 0.26
21 0.27
22 0.25
23 0.25
24 0.23
25 0.3
26 0.3
27 0.33
28 0.36
29 0.39
30 0.5
31 0.57
32 0.61
33 0.61
34 0.66
35 0.72
36 0.74
37 0.77
38 0.75
39 0.73
40 0.68
41 0.63
42 0.62
43 0.52
44 0.45
45 0.36
46 0.27
47 0.18
48 0.16
49 0.13
50 0.09
51 0.1
52 0.09
53 0.09
54 0.1
55 0.1
56 0.08
57 0.09
58 0.09
59 0.08
60 0.08
61 0.09
62 0.1
63 0.1
64 0.11
65 0.13
66 0.15
67 0.15
68 0.14
69 0.13
70 0.17
71 0.22
72 0.27
73 0.28
74 0.28
75 0.29
76 0.31
77 0.3
78 0.27
79 0.24
80 0.18
81 0.19
82 0.18
83 0.18
84 0.17
85 0.18
86 0.17
87 0.19
88 0.2
89 0.16
90 0.21
91 0.22
92 0.23
93 0.22
94 0.24
95 0.2
96 0.22
97 0.21
98 0.2
99 0.22
100 0.23
101 0.25
102 0.29
103 0.32
104 0.31
105 0.3
106 0.28
107 0.25
108 0.25
109 0.22
110 0.18
111 0.15
112 0.14
113 0.14
114 0.12
115 0.12
116 0.1
117 0.11
118 0.11
119 0.1
120 0.1
121 0.11
122 0.12
123 0.11
124 0.1
125 0.1
126 0.11
127 0.11
128 0.12
129 0.11
130 0.12
131 0.11
132 0.11
133 0.1
134 0.09
135 0.08
136 0.07
137 0.09
138 0.08
139 0.09
140 0.13
141 0.18
142 0.24
143 0.35
144 0.41
145 0.47
146 0.55
147 0.56
148 0.56
149 0.57
150 0.6
151 0.53
152 0.52
153 0.47
154 0.41
155 0.4
156 0.38
157 0.32
158 0.22
159 0.19
160 0.16
161 0.13
162 0.1
163 0.08
164 0.07
165 0.07
166 0.08
167 0.07
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.04
174 0.04
175 0.05
176 0.04
177 0.04
178 0.04
179 0.05
180 0.05
181 0.05
182 0.05
183 0.04
184 0.04
185 0.05
186 0.05
187 0.05
188 0.09
189 0.1
190 0.11
191 0.12
192 0.16
193 0.17
194 0.2
195 0.22
196 0.24
197 0.32
198 0.33
199 0.33
200 0.38
201 0.42
202 0.47
203 0.56
204 0.61
205 0.62
206 0.7
207 0.78
208 0.8
209 0.83
210 0.82
211 0.8
212 0.8
213 0.75
214 0.74
215 0.68
216 0.58
217 0.51
218 0.44
219 0.38
220 0.34
221 0.33
222 0.29
223 0.35
224 0.39
225 0.43
226 0.51
227 0.57
228 0.62
229 0.65
230 0.68
231 0.68
232 0.64
233 0.6
234 0.51
235 0.44
236 0.34
237 0.25
238 0.18
239 0.11
240 0.09
241 0.09
242 0.09
243 0.09
244 0.14
245 0.18
246 0.2
247 0.22
248 0.23
249 0.3
250 0.33
251 0.38
252 0.35
253 0.31
254 0.29
255 0.33
256 0.32
257 0.25
258 0.23
259 0.17
260 0.15
261 0.15
262 0.14
263 0.11
264 0.1
265 0.1
266 0.09
267 0.09
268 0.08
269 0.07
270 0.08
271 0.06
272 0.06
273 0.06
274 0.06
275 0.07
276 0.08
277 0.08
278 0.07
279 0.07
280 0.06
281 0.06
282 0.08
283 0.07
284 0.09
285 0.09
286 0.1
287 0.1
288 0.11
289 0.13
290 0.13
291 0.12
292 0.11
293 0.14
294 0.14
295 0.14
296 0.17
297 0.18
298 0.22
299 0.23
300 0.24
301 0.24
302 0.3
303 0.38
304 0.45
305 0.51
306 0.53
307 0.57
308 0.57
309 0.53
310 0.47
311 0.41
312 0.35
313 0.28
314 0.2
315 0.16
316 0.16
317 0.16
318 0.15
319 0.12
320 0.07
321 0.06
322 0.06
323 0.06
324 0.04
325 0.04
326 0.05
327 0.05
328 0.04
329 0.04
330 0.05
331 0.05
332 0.05
333 0.07
334 0.07
335 0.07
336 0.13
337 0.13
338 0.14
339 0.14
340 0.15
341 0.15
342 0.18
343 0.19
344 0.14
345 0.16
346 0.14
347 0.16
348 0.16
349 0.17
350 0.22
351 0.28
352 0.32
353 0.35
354 0.38
355 0.38
356 0.38
357 0.36
358 0.29
359 0.22
360 0.17
361 0.14