Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094A2T1

Protein Details
Accession A0A094A2T1    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-35MMGYEKYRRHKARKAMKKDLAAHydrophilic
NLS Segment(s)
PositionSequence
21-31RRHKARKAMKK
Subcellular Location(s) mito 9, extr 8, nucl 3, E.R. 3, plas 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MAAVILMAIVVLPMMGYEKYRRHKARKAMKKDLAAQSELRRGGHQAAWEQSGDQPPSYDDTVGSHPSPPYSPNRPPGYIERTSGNPELAVGHLPGSHISPTAVSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.07
4 0.12
5 0.2
6 0.28
7 0.38
8 0.47
9 0.54
10 0.62
11 0.71
12 0.77
13 0.8
14 0.83
15 0.83
16 0.82
17 0.79
18 0.78
19 0.75
20 0.67
21 0.59
22 0.52
23 0.45
24 0.43
25 0.38
26 0.31
27 0.24
28 0.22
29 0.22
30 0.2
31 0.19
32 0.16
33 0.16
34 0.17
35 0.16
36 0.15
37 0.15
38 0.16
39 0.15
40 0.13
41 0.11
42 0.1
43 0.13
44 0.13
45 0.12
46 0.08
47 0.1
48 0.13
49 0.15
50 0.15
51 0.14
52 0.13
53 0.14
54 0.15
55 0.16
56 0.2
57 0.25
58 0.3
59 0.37
60 0.42
61 0.43
62 0.46
63 0.5
64 0.5
65 0.46
66 0.42
67 0.37
68 0.34
69 0.38
70 0.36
71 0.29
72 0.22
73 0.19
74 0.18
75 0.16
76 0.15
77 0.1
78 0.09
79 0.09
80 0.1
81 0.1
82 0.11
83 0.11
84 0.1
85 0.1