Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094ANY4

Protein Details
Accession A0A094ANY4   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
66-97QSQSKSDDSKPKPNKPRRSERLKAKRLRDDALHydrophilic
NLS Segment(s)
PositionSequence
73-93DSKPKPNKPRRSERLKAKRLR
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MSSQNCSITEGQKRDEKINVIKEKGRSLEVKKTMWRYYNSPRVDGKEGKGGPPQLAKVPKQSKPDQSQSKSDDSKPKPNKPRRSERLKAKRLRDDALH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.44
4 0.43
5 0.49
6 0.51
7 0.5
8 0.52
9 0.51
10 0.51
11 0.47
12 0.43
13 0.39
14 0.37
15 0.42
16 0.43
17 0.43
18 0.45
19 0.48
20 0.49
21 0.49
22 0.47
23 0.44
24 0.48
25 0.53
26 0.49
27 0.47
28 0.45
29 0.44
30 0.46
31 0.42
32 0.34
33 0.33
34 0.32
35 0.3
36 0.3
37 0.27
38 0.23
39 0.22
40 0.21
41 0.18
42 0.23
43 0.22
44 0.29
45 0.35
46 0.39
47 0.44
48 0.49
49 0.53
50 0.56
51 0.64
52 0.65
53 0.62
54 0.64
55 0.62
56 0.64
57 0.59
58 0.58
59 0.58
60 0.54
61 0.61
62 0.63
63 0.69
64 0.73
65 0.79
66 0.84
67 0.84
68 0.89
69 0.88
70 0.89
71 0.89
72 0.89
73 0.9
74 0.89
75 0.89
76 0.87
77 0.88
78 0.83