Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4JJ19

Protein Details
Accession C4JJ19    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
153-179LTNRVLEEENKRKRRRKDLASNETLQSHydrophilic
NLS Segment(s)
PositionSequence
90-101LKKAPGSRKRKK
163-169KRKRRRK
Subcellular Location(s) mito 16.5, mito_nucl 14, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
IPR027799  Rtf2_RING-finger  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
KEGG ure:UREG_01626  -  
Pfam View protein in Pfam  
PF04641  Rtf2  
CDD cd16653  RING-like_Rtf2  
Amino Acid Sequences MAMRRSKGGLPAPVTNKELGPSVKSVYLVPCGHAFSEEAIREMKSDKCLQCNESYSPENIIPILPTKESEKERLLSRKQKLSNEGLTHSLKKAPGSRKRKKTGAIPSVVTGEPTTDVAAEKSSSAQNDRLISRTSTPLPSTTGGIKNAATAMLTNRVLEEENKRKRRRKDLASNETLQSLFTSSSKNQKTKDGDFMTRGFSIPSGARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.44
3 0.38
4 0.33
5 0.33
6 0.26
7 0.24
8 0.22
9 0.22
10 0.22
11 0.22
12 0.23
13 0.21
14 0.26
15 0.23
16 0.23
17 0.22
18 0.22
19 0.21
20 0.21
21 0.19
22 0.14
23 0.19
24 0.18
25 0.17
26 0.17
27 0.17
28 0.17
29 0.19
30 0.19
31 0.18
32 0.26
33 0.27
34 0.32
35 0.36
36 0.38
37 0.41
38 0.42
39 0.4
40 0.38
41 0.37
42 0.32
43 0.32
44 0.29
45 0.24
46 0.2
47 0.17
48 0.12
49 0.13
50 0.14
51 0.11
52 0.12
53 0.14
54 0.2
55 0.22
56 0.26
57 0.26
58 0.27
59 0.33
60 0.4
61 0.45
62 0.49
63 0.52
64 0.56
65 0.58
66 0.6
67 0.59
68 0.57
69 0.55
70 0.48
71 0.44
72 0.4
73 0.37
74 0.34
75 0.29
76 0.26
77 0.2
78 0.2
79 0.26
80 0.3
81 0.38
82 0.48
83 0.57
84 0.64
85 0.7
86 0.73
87 0.7
88 0.69
89 0.69
90 0.66
91 0.59
92 0.5
93 0.44
94 0.42
95 0.38
96 0.29
97 0.19
98 0.12
99 0.09
100 0.08
101 0.07
102 0.05
103 0.05
104 0.05
105 0.06
106 0.06
107 0.06
108 0.07
109 0.08
110 0.09
111 0.11
112 0.13
113 0.15
114 0.18
115 0.19
116 0.19
117 0.2
118 0.2
119 0.2
120 0.22
121 0.21
122 0.21
123 0.21
124 0.2
125 0.21
126 0.2
127 0.2
128 0.21
129 0.22
130 0.2
131 0.2
132 0.19
133 0.17
134 0.16
135 0.15
136 0.1
137 0.08
138 0.08
139 0.12
140 0.13
141 0.12
142 0.12
143 0.13
144 0.14
145 0.17
146 0.24
147 0.29
148 0.4
149 0.5
150 0.59
151 0.67
152 0.75
153 0.83
154 0.84
155 0.85
156 0.85
157 0.87
158 0.88
159 0.87
160 0.81
161 0.71
162 0.63
163 0.52
164 0.4
165 0.3
166 0.2
167 0.15
168 0.12
169 0.15
170 0.17
171 0.27
172 0.35
173 0.4
174 0.41
175 0.49
176 0.55
177 0.56
178 0.63
179 0.6
180 0.57
181 0.55
182 0.55
183 0.5
184 0.44
185 0.39
186 0.29
187 0.23
188 0.21