Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093ZZ35

Protein Details
Accession A0A093ZZ35   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
131-158GAPGKDKQAAPQKKKKVKKVKLSFGDDEHydrophilic
NLS Segment(s)
PositionSequence
108-111RKRK
133-151PGKDKQAAPQKKKKVKKVK
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSPKITSKSLSYDASLPPFLQRLRAENTGASTAAPRPKRAPNPDADEEDEPVYVDEEGGALDDAELRSLGVTKKGEEKGEEAAEEAKPLALGESERKEVKIAEIGTARKRKVGKVVGASEEEGKDGNTVAGAPGKDKQAAPQKKKKVKKVKLSFGDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.26
4 0.23
5 0.25
6 0.24
7 0.26
8 0.25
9 0.26
10 0.31
11 0.34
12 0.33
13 0.3
14 0.33
15 0.28
16 0.26
17 0.21
18 0.17
19 0.18
20 0.24
21 0.25
22 0.26
23 0.29
24 0.38
25 0.47
26 0.53
27 0.54
28 0.54
29 0.6
30 0.61
31 0.6
32 0.55
33 0.47
34 0.41
35 0.36
36 0.28
37 0.2
38 0.15
39 0.12
40 0.08
41 0.07
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.06
57 0.09
58 0.09
59 0.1
60 0.16
61 0.18
62 0.19
63 0.19
64 0.2
65 0.19
66 0.19
67 0.18
68 0.13
69 0.12
70 0.11
71 0.1
72 0.09
73 0.06
74 0.05
75 0.05
76 0.05
77 0.04
78 0.05
79 0.08
80 0.11
81 0.14
82 0.14
83 0.15
84 0.15
85 0.15
86 0.15
87 0.16
88 0.14
89 0.15
90 0.18
91 0.21
92 0.28
93 0.34
94 0.33
95 0.33
96 0.34
97 0.33
98 0.38
99 0.42
100 0.41
101 0.43
102 0.46
103 0.45
104 0.44
105 0.43
106 0.36
107 0.3
108 0.24
109 0.17
110 0.13
111 0.1
112 0.09
113 0.08
114 0.06
115 0.06
116 0.06
117 0.1
118 0.09
119 0.11
120 0.14
121 0.16
122 0.19
123 0.19
124 0.26
125 0.33
126 0.44
127 0.52
128 0.59
129 0.68
130 0.76
131 0.85
132 0.88
133 0.89
134 0.89
135 0.91
136 0.91
137 0.91
138 0.91