Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JUC7

Protein Details
Accession C4JUC7    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
40-60LSNLLKKLNEKLRKKKFCLIVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR043128  Rev_trsase/Diguanyl_cyclase  
KEGG ure:UREG_06066  -  
Amino Acid Sequences MDVIVKWPVPKNMHEVQQFLDLVTFYQQFIKNFVRITTPLSNLLKKLNEKLRKKKFCLIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.41
3 0.36
4 0.38
5 0.36
6 0.29
7 0.24
8 0.16
9 0.13
10 0.14
11 0.12
12 0.07
13 0.11
14 0.14
15 0.14
16 0.18
17 0.2
18 0.19
19 0.2
20 0.2
21 0.19
22 0.17
23 0.23
24 0.22
25 0.22
26 0.26
27 0.29
28 0.3
29 0.29
30 0.32
31 0.32
32 0.31
33 0.38
34 0.42
35 0.49
36 0.57
37 0.67
38 0.74
39 0.79
40 0.83