Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093ZU24

Protein Details
Accession A0A093ZU24   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
18-49EMKLGFKREKCKNMAKTPKKPKHPIYERLNPAHydrophilic
NLS Segment(s)
PositionSequence
33-39KTPKKPK
Subcellular Location(s) cyto 10, cyto_mito 7.833, cyto_nucl 6.333, E.R. 5, mito 4.5, plas 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021842  DUF3435  
Pfam View protein in Pfam  
PF11917  DUF3435  
Amino Acid Sequences MLGKDIVCMVAWKDGEPEMKLGFKREKCKNMAKTPKKPKHPIYERLNPAPPLLANPLLFLLSVFILSNAFKNYKTVEDVFSTRAPKGKYHIMEWAHDVLDIPVFPEMSMDGLTEKAKNEASWGKQCSEWAKRADFPHGMGLHATRREVLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.21
4 0.22
5 0.19
6 0.23
7 0.24
8 0.28
9 0.33
10 0.37
11 0.45
12 0.52
13 0.58
14 0.6
15 0.69
16 0.73
17 0.75
18 0.8
19 0.81
20 0.83
21 0.86
22 0.89
23 0.89
24 0.89
25 0.86
26 0.86
27 0.85
28 0.84
29 0.81
30 0.82
31 0.78
32 0.74
33 0.7
34 0.59
35 0.5
36 0.42
37 0.33
38 0.25
39 0.22
40 0.18
41 0.14
42 0.14
43 0.14
44 0.12
45 0.12
46 0.09
47 0.07
48 0.05
49 0.05
50 0.04
51 0.04
52 0.05
53 0.05
54 0.06
55 0.07
56 0.08
57 0.08
58 0.09
59 0.1
60 0.11
61 0.13
62 0.13
63 0.14
64 0.15
65 0.16
66 0.18
67 0.19
68 0.19
69 0.17
70 0.2
71 0.2
72 0.19
73 0.22
74 0.26
75 0.25
76 0.26
77 0.32
78 0.3
79 0.3
80 0.31
81 0.29
82 0.22
83 0.2
84 0.18
85 0.11
86 0.1
87 0.09
88 0.07
89 0.06
90 0.06
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.06
97 0.06
98 0.07
99 0.08
100 0.09
101 0.1
102 0.11
103 0.12
104 0.12
105 0.16
106 0.21
107 0.27
108 0.33
109 0.36
110 0.35
111 0.35
112 0.39
113 0.42
114 0.43
115 0.43
116 0.4
117 0.42
118 0.46
119 0.47
120 0.51
121 0.45
122 0.4
123 0.43
124 0.38
125 0.34
126 0.3
127 0.3
128 0.3
129 0.3
130 0.29