Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094ANX4

Protein Details
Accession A0A094ANX4    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
217-251EGSKTQTRRVRGSRRGRPRFPKRKNRQLNRDSVATHydrophilic
NLS Segment(s)
PositionSequence
222-242QTRRVRGSRRGRPRFPKRKNR
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MPPQVSPLCSCGQKLKSGTALAQHLRYSPRHNKSHIEGNAATKPVNSKTKLEGLTLVAKEANVPLINCQTKIKNEESESNGISIEEPPKGKFEWTFANITESQRPHDSLHGKLGEQLECESTQELKAAIKKKLKPVLKRTLEDDIKAEFGGDLKKLKSEMMSDLMSGLTSDFKKAVKKEIENEFKMTVAYQLSSKNKTKANPVDDVNSESKPELRAEGSKTQTRRVRGSRRGRPRFPKRKNRQLNRDSVATAVDGAVVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.4
4 0.4
5 0.4
6 0.37
7 0.41
8 0.37
9 0.38
10 0.34
11 0.33
12 0.35
13 0.37
14 0.4
15 0.44
16 0.49
17 0.53
18 0.57
19 0.6
20 0.61
21 0.68
22 0.61
23 0.58
24 0.51
25 0.5
26 0.5
27 0.44
28 0.39
29 0.3
30 0.3
31 0.3
32 0.35
33 0.32
34 0.31
35 0.34
36 0.42
37 0.42
38 0.4
39 0.35
40 0.31
41 0.35
42 0.32
43 0.28
44 0.21
45 0.19
46 0.18
47 0.16
48 0.16
49 0.1
50 0.1
51 0.12
52 0.19
53 0.2
54 0.21
55 0.24
56 0.24
57 0.27
58 0.32
59 0.33
60 0.32
61 0.33
62 0.38
63 0.4
64 0.4
65 0.36
66 0.32
67 0.28
68 0.22
69 0.2
70 0.16
71 0.14
72 0.12
73 0.13
74 0.13
75 0.15
76 0.15
77 0.16
78 0.15
79 0.16
80 0.2
81 0.22
82 0.23
83 0.21
84 0.25
85 0.25
86 0.27
87 0.29
88 0.23
89 0.23
90 0.23
91 0.24
92 0.21
93 0.26
94 0.27
95 0.23
96 0.28
97 0.26
98 0.25
99 0.26
100 0.28
101 0.22
102 0.2
103 0.18
104 0.14
105 0.13
106 0.13
107 0.1
108 0.09
109 0.08
110 0.08
111 0.08
112 0.08
113 0.13
114 0.17
115 0.22
116 0.28
117 0.31
118 0.38
119 0.46
120 0.5
121 0.54
122 0.59
123 0.64
124 0.63
125 0.62
126 0.58
127 0.59
128 0.53
129 0.46
130 0.38
131 0.28
132 0.22
133 0.21
134 0.17
135 0.08
136 0.08
137 0.09
138 0.08
139 0.1
140 0.09
141 0.1
142 0.11
143 0.11
144 0.11
145 0.12
146 0.13
147 0.15
148 0.15
149 0.14
150 0.14
151 0.13
152 0.12
153 0.1
154 0.08
155 0.07
156 0.07
157 0.08
158 0.09
159 0.11
160 0.16
161 0.17
162 0.25
163 0.29
164 0.33
165 0.39
166 0.48
167 0.55
168 0.53
169 0.54
170 0.46
171 0.39
172 0.36
173 0.29
174 0.21
175 0.13
176 0.11
177 0.1
178 0.17
179 0.21
180 0.27
181 0.31
182 0.35
183 0.38
184 0.4
185 0.48
186 0.5
187 0.51
188 0.5
189 0.48
190 0.48
191 0.45
192 0.48
193 0.41
194 0.33
195 0.29
196 0.24
197 0.23
198 0.2
199 0.19
200 0.17
201 0.17
202 0.21
203 0.25
204 0.32
205 0.37
206 0.41
207 0.43
208 0.49
209 0.52
210 0.53
211 0.57
212 0.59
213 0.64
214 0.68
215 0.77
216 0.78
217 0.84
218 0.89
219 0.9
220 0.91
221 0.92
222 0.93
223 0.93
224 0.94
225 0.93
226 0.94
227 0.95
228 0.95
229 0.95
230 0.93
231 0.93
232 0.87
233 0.8
234 0.69
235 0.59
236 0.49
237 0.38
238 0.29
239 0.18