Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JPA6

Protein Details
Accession C4JPA6   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
283-304EDAGRRRERKRAEGLQRRELERBasic
NLS Segment(s)
PositionSequence
287-295RRRERKRAE
Subcellular Location(s) cyto 10.5, cyto_mito 9.5, nucl 9, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003827  tRNA_yW-synthesising  
IPR036602  tRNA_yW-synthesising-like_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
GO:0008033  P:tRNA processing  
KEGG ure:UREG_04488  -  
Pfam View protein in Pfam  
PF02676  TYW3  
Amino Acid Sequences MTTSSRSFEAKKLKILSALTIPDEAYTDLSPKGSVDTGVRDLIRDINQLQGLVTTSSCAGRISVFFEGVGSDVRNSQADRIQREEASDEPNVDSERSRQFAPTGGKGSGKWQFVSHDPIEVDDSKPSFHDLFNLQPTRGSIRPGSNSQLRLARFHFEPMILHVMAESLKHAQPVLTAASSAGFRESGIQSLRCLDDKNTCPIVAVRSSGLAVESIIGYVDNDSADGEAVVRSLVTEEYLHMLVLIANERFKTNYSRMDRFRTKLMALSTGSPSRMSSQNKGWEDAGRRRERKRAEGLQRRELERQAAQAIEKPPESEDEITIPFWGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.49
3 0.45
4 0.4
5 0.39
6 0.32
7 0.29
8 0.26
9 0.22
10 0.21
11 0.18
12 0.15
13 0.13
14 0.13
15 0.13
16 0.13
17 0.13
18 0.12
19 0.14
20 0.12
21 0.13
22 0.13
23 0.17
24 0.19
25 0.23
26 0.22
27 0.21
28 0.21
29 0.24
30 0.24
31 0.23
32 0.21
33 0.22
34 0.23
35 0.22
36 0.21
37 0.17
38 0.16
39 0.14
40 0.13
41 0.09
42 0.09
43 0.09
44 0.1
45 0.09
46 0.08
47 0.09
48 0.1
49 0.13
50 0.13
51 0.13
52 0.12
53 0.12
54 0.12
55 0.11
56 0.12
57 0.08
58 0.08
59 0.08
60 0.1
61 0.11
62 0.12
63 0.13
64 0.17
65 0.21
66 0.24
67 0.28
68 0.3
69 0.29
70 0.3
71 0.3
72 0.27
73 0.26
74 0.23
75 0.2
76 0.17
77 0.18
78 0.17
79 0.16
80 0.15
81 0.15
82 0.18
83 0.19
84 0.19
85 0.19
86 0.19
87 0.24
88 0.28
89 0.28
90 0.27
91 0.26
92 0.27
93 0.26
94 0.31
95 0.31
96 0.28
97 0.24
98 0.22
99 0.23
100 0.24
101 0.3
102 0.25
103 0.22
104 0.21
105 0.21
106 0.22
107 0.21
108 0.2
109 0.15
110 0.15
111 0.12
112 0.13
113 0.15
114 0.13
115 0.11
116 0.14
117 0.13
118 0.17
119 0.24
120 0.25
121 0.22
122 0.22
123 0.23
124 0.25
125 0.24
126 0.22
127 0.18
128 0.2
129 0.24
130 0.25
131 0.29
132 0.28
133 0.29
134 0.29
135 0.3
136 0.27
137 0.26
138 0.26
139 0.24
140 0.2
141 0.21
142 0.19
143 0.14
144 0.14
145 0.13
146 0.15
147 0.12
148 0.11
149 0.09
150 0.09
151 0.09
152 0.09
153 0.07
154 0.06
155 0.07
156 0.07
157 0.07
158 0.07
159 0.07
160 0.09
161 0.09
162 0.07
163 0.06
164 0.06
165 0.07
166 0.07
167 0.07
168 0.06
169 0.05
170 0.05
171 0.07
172 0.08
173 0.1
174 0.11
175 0.12
176 0.12
177 0.13
178 0.15
179 0.13
180 0.14
181 0.13
182 0.19
183 0.21
184 0.27
185 0.27
186 0.25
187 0.25
188 0.25
189 0.26
190 0.19
191 0.18
192 0.12
193 0.11
194 0.11
195 0.11
196 0.1
197 0.07
198 0.06
199 0.05
200 0.05
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.03
218 0.03
219 0.04
220 0.04
221 0.05
222 0.05
223 0.06
224 0.08
225 0.09
226 0.09
227 0.08
228 0.08
229 0.08
230 0.08
231 0.1
232 0.08
233 0.09
234 0.1
235 0.11
236 0.12
237 0.13
238 0.18
239 0.21
240 0.3
241 0.36
242 0.44
243 0.48
244 0.57
245 0.62
246 0.59
247 0.6
248 0.54
249 0.48
250 0.44
251 0.41
252 0.37
253 0.31
254 0.31
255 0.3
256 0.29
257 0.28
258 0.24
259 0.23
260 0.23
261 0.29
262 0.31
263 0.32
264 0.37
265 0.46
266 0.48
267 0.49
268 0.47
269 0.46
270 0.48
271 0.52
272 0.55
273 0.55
274 0.6
275 0.63
276 0.71
277 0.72
278 0.73
279 0.74
280 0.75
281 0.76
282 0.79
283 0.82
284 0.83
285 0.81
286 0.77
287 0.72
288 0.64
289 0.59
290 0.51
291 0.47
292 0.4
293 0.35
294 0.32
295 0.34
296 0.34
297 0.33
298 0.31
299 0.28
300 0.26
301 0.27
302 0.31
303 0.27
304 0.25
305 0.24
306 0.25
307 0.24