Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094A7R7

Protein Details
Accession A0A094A7R7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
66-91SISTQGKAVKKNKKKADEKKDTETPQHydrophilic
NLS Segment(s)
PositionSequence
74-82VKKNKKKAD
Subcellular Location(s) mito 12.5, mito_nucl 11.332, nucl 8.5, cyto_nucl 7.833, cyto 3
Family & Domain DBs
Amino Acid Sequences MFRLLSRSGLVDFFQARVLLLYICDDDVKSEAVISDSEEVQVPSEVESDSDSAIYSDISEDSSDSSISTQGKAVKKNKKKADEKKDTETPQAQRRNTDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.13
4 0.12
5 0.12
6 0.09
7 0.08
8 0.09
9 0.08
10 0.08
11 0.09
12 0.08
13 0.08
14 0.09
15 0.09
16 0.08
17 0.07
18 0.07
19 0.07
20 0.08
21 0.08
22 0.08
23 0.07
24 0.08
25 0.08
26 0.08
27 0.08
28 0.08
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.05
47 0.05
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.09
54 0.09
55 0.1
56 0.11
57 0.18
58 0.22
59 0.3
60 0.39
61 0.47
62 0.56
63 0.65
64 0.73
65 0.77
66 0.83
67 0.86
68 0.89
69 0.89
70 0.87
71 0.85
72 0.85
73 0.78
74 0.76
75 0.72
76 0.69
77 0.67
78 0.69
79 0.64