Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094A2L6

Protein Details
Accession A0A094A2L6   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
35-68TGSTDAAERRKRQNRLHQRKYRKKMKELKMLAASHydrophilic
NLS Segment(s)
PositionSequence
43-60RRKRQNRLHQRKYRKKMK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, cyto 4.5, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021833  DUF3425  
Pfam View protein in Pfam  
PF11905  DUF3425  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MGPDERSWGEIRHPEVLLGRMPQQAEVRVAEDDWTGSTDAAERRKRQNRLHQRKYRKKMKELKMLAASTGSFEQGPDQTCPSDVPHSVASLGDVTPDTQYTLPTDLHGPSQPSEPQYRHASPTPGLPASQVQGVIARVEDFLSQQHIVSSPRVDLLLTLIQFNVFRALVSNTFTLGFPFSWLSAEADSPYNLGESRWCCPASLQPTALQRKVPHHPWIDLFPFPGLRDNMLSQGEDFDDDDLCYDLVEVCHAPSERSGLIVWSDPWDPLGWEATTEFIGKWGWMLRGCPELLFSTNNWRGKRGEEAIVFDVTPLESVHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.33
4 0.3
5 0.26
6 0.27
7 0.25
8 0.25
9 0.27
10 0.27
11 0.28
12 0.27
13 0.26
14 0.24
15 0.22
16 0.22
17 0.19
18 0.17
19 0.14
20 0.12
21 0.12
22 0.11
23 0.1
24 0.1
25 0.13
26 0.18
27 0.26
28 0.33
29 0.37
30 0.47
31 0.57
32 0.65
33 0.71
34 0.77
35 0.8
36 0.84
37 0.9
38 0.9
39 0.92
40 0.94
41 0.95
42 0.94
43 0.92
44 0.92
45 0.91
46 0.91
47 0.9
48 0.84
49 0.82
50 0.78
51 0.69
52 0.59
53 0.49
54 0.39
55 0.3
56 0.25
57 0.17
58 0.1
59 0.09
60 0.11
61 0.12
62 0.15
63 0.14
64 0.16
65 0.15
66 0.16
67 0.17
68 0.18
69 0.19
70 0.17
71 0.18
72 0.17
73 0.17
74 0.17
75 0.16
76 0.14
77 0.11
78 0.1
79 0.08
80 0.07
81 0.07
82 0.08
83 0.08
84 0.09
85 0.08
86 0.08
87 0.09
88 0.11
89 0.11
90 0.11
91 0.13
92 0.12
93 0.14
94 0.16
95 0.16
96 0.15
97 0.17
98 0.19
99 0.19
100 0.24
101 0.23
102 0.26
103 0.31
104 0.32
105 0.33
106 0.34
107 0.34
108 0.29
109 0.32
110 0.31
111 0.24
112 0.22
113 0.19
114 0.17
115 0.15
116 0.15
117 0.12
118 0.08
119 0.09
120 0.09
121 0.08
122 0.07
123 0.06
124 0.06
125 0.06
126 0.06
127 0.05
128 0.06
129 0.08
130 0.08
131 0.08
132 0.08
133 0.09
134 0.1
135 0.11
136 0.11
137 0.09
138 0.09
139 0.09
140 0.08
141 0.07
142 0.08
143 0.09
144 0.09
145 0.09
146 0.08
147 0.08
148 0.08
149 0.09
150 0.08
151 0.05
152 0.05
153 0.06
154 0.08
155 0.08
156 0.1
157 0.1
158 0.09
159 0.1
160 0.1
161 0.09
162 0.09
163 0.08
164 0.07
165 0.08
166 0.07
167 0.07
168 0.08
169 0.08
170 0.08
171 0.08
172 0.08
173 0.09
174 0.08
175 0.08
176 0.07
177 0.07
178 0.07
179 0.06
180 0.1
181 0.11
182 0.13
183 0.16
184 0.16
185 0.16
186 0.17
187 0.23
188 0.24
189 0.26
190 0.25
191 0.26
192 0.34
193 0.39
194 0.39
195 0.36
196 0.34
197 0.36
198 0.42
199 0.43
200 0.42
201 0.41
202 0.42
203 0.41
204 0.43
205 0.4
206 0.34
207 0.29
208 0.23
209 0.21
210 0.19
211 0.22
212 0.17
213 0.15
214 0.17
215 0.17
216 0.19
217 0.19
218 0.19
219 0.14
220 0.14
221 0.13
222 0.12
223 0.12
224 0.09
225 0.08
226 0.08
227 0.08
228 0.08
229 0.07
230 0.06
231 0.06
232 0.06
233 0.06
234 0.07
235 0.07
236 0.07
237 0.11
238 0.11
239 0.11
240 0.11
241 0.15
242 0.14
243 0.15
244 0.15
245 0.12
246 0.13
247 0.14
248 0.14
249 0.13
250 0.14
251 0.13
252 0.13
253 0.13
254 0.12
255 0.12
256 0.14
257 0.11
258 0.11
259 0.11
260 0.12
261 0.12
262 0.13
263 0.11
264 0.1
265 0.1
266 0.09
267 0.11
268 0.12
269 0.15
270 0.15
271 0.17
272 0.19
273 0.23
274 0.23
275 0.21
276 0.2
277 0.2
278 0.21
279 0.21
280 0.2
281 0.26
282 0.34
283 0.4
284 0.4
285 0.4
286 0.4
287 0.41
288 0.48
289 0.42
290 0.42
291 0.39
292 0.43
293 0.43
294 0.42
295 0.39
296 0.3
297 0.26
298 0.18
299 0.16