Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094AM33

Protein Details
Accession A0A094AM33   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
7-43LPPTPSSLRKPANKGKKGKRGKKGKGKPKPGAKEANLBasic
NLS Segment(s)
PositionSequence
15-39RKPANKGKKGKRGKKGKGKPKPGAK
Subcellular Location(s) nucl 15, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046539  DUF6604  
Pfam View protein in Pfam  
PF20253  DUF6604  
Amino Acid Sequences MAPTNCLPPTPSSLRKPANKGKKGKRGKKGKGKPKPGAKEANLDEVPLESYRIIEDEDGLVTDYLIAVYSYARQWIVLRRHLQGQWREVPYDGLNSAVAGALSNAATAMVKQTESAFFIDYPGGHESYETVMRTITRGDPGNAQGKFQMQLYEVEDRTRTVKEVHNSDVDVKEETMFYAYRDLLDFIADFQKTRNGKPTKAMLSEIRNWDPVFNLRGANKEQRIKWRRTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.64
3 0.71
4 0.74
5 0.76
6 0.78
7 0.82
8 0.84
9 0.86
10 0.89
11 0.9
12 0.9
13 0.9
14 0.91
15 0.92
16 0.92
17 0.93
18 0.92
19 0.93
20 0.92
21 0.92
22 0.9
23 0.86
24 0.85
25 0.77
26 0.75
27 0.67
28 0.66
29 0.55
30 0.46
31 0.38
32 0.29
33 0.27
34 0.18
35 0.17
36 0.08
37 0.08
38 0.08
39 0.09
40 0.09
41 0.07
42 0.08
43 0.07
44 0.08
45 0.08
46 0.08
47 0.07
48 0.06
49 0.06
50 0.05
51 0.04
52 0.04
53 0.04
54 0.03
55 0.04
56 0.05
57 0.06
58 0.07
59 0.07
60 0.07
61 0.09
62 0.17
63 0.22
64 0.28
65 0.31
66 0.32
67 0.37
68 0.39
69 0.44
70 0.42
71 0.42
72 0.42
73 0.4
74 0.39
75 0.34
76 0.34
77 0.27
78 0.24
79 0.18
80 0.11
81 0.1
82 0.09
83 0.08
84 0.06
85 0.06
86 0.04
87 0.04
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.04
96 0.04
97 0.04
98 0.04
99 0.05
100 0.06
101 0.07
102 0.08
103 0.08
104 0.07
105 0.08
106 0.08
107 0.07
108 0.09
109 0.09
110 0.09
111 0.08
112 0.08
113 0.08
114 0.1
115 0.12
116 0.1
117 0.09
118 0.09
119 0.09
120 0.09
121 0.1
122 0.1
123 0.11
124 0.12
125 0.13
126 0.15
127 0.18
128 0.25
129 0.23
130 0.23
131 0.2
132 0.2
133 0.2
134 0.18
135 0.17
136 0.11
137 0.13
138 0.15
139 0.19
140 0.18
141 0.18
142 0.18
143 0.18
144 0.19
145 0.17
146 0.16
147 0.15
148 0.2
149 0.25
150 0.29
151 0.31
152 0.31
153 0.32
154 0.33
155 0.32
156 0.27
157 0.23
158 0.19
159 0.16
160 0.14
161 0.13
162 0.12
163 0.1
164 0.1
165 0.11
166 0.11
167 0.11
168 0.12
169 0.12
170 0.11
171 0.11
172 0.11
173 0.09
174 0.14
175 0.14
176 0.13
177 0.13
178 0.21
179 0.23
180 0.26
181 0.34
182 0.34
183 0.37
184 0.44
185 0.52
186 0.51
187 0.51
188 0.53
189 0.49
190 0.5
191 0.55
192 0.55
193 0.49
194 0.46
195 0.43
196 0.39
197 0.36
198 0.34
199 0.3
200 0.25
201 0.26
202 0.25
203 0.29
204 0.35
205 0.41
206 0.44
207 0.49
208 0.53
209 0.6
210 0.67