Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094AAS7

Protein Details
Accession A0A094AAS7    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
33-59ERWRVEEEERRKRRRERRSNKENGGDGBasic
83-107IMKARSEKEKKAREEREKARRARAIBasic
NLS Segment(s)
PositionSequence
41-72ERRKRRRERRSNKENGGDGGGKEKRSRVDKDK
84-106MKARSEKEKKAREEREKARRARA
Subcellular Location(s) nucl 14, cyto_nucl 12.5, cyto 9, mito 4
Family & Domain DBs
Amino Acid Sequences WREGVRFREEVLRVPWVVTEEEERRCREEAEGERWRVEEEERRKRRRERRSNKENGGDGGGKEKRSRVDKDKVDSKVEEDNAIMKARSEKEKKAREEREKARRARAIQRLICSRPEEAGKYAALGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.22
4 0.22
5 0.19
6 0.22
7 0.22
8 0.29
9 0.33
10 0.34
11 0.35
12 0.35
13 0.35
14 0.3
15 0.34
16 0.33
17 0.38
18 0.43
19 0.42
20 0.42
21 0.41
22 0.4
23 0.32
24 0.29
25 0.29
26 0.31
27 0.41
28 0.5
29 0.56
30 0.63
31 0.72
32 0.79
33 0.81
34 0.83
35 0.83
36 0.84
37 0.88
38 0.91
39 0.88
40 0.83
41 0.74
42 0.63
43 0.55
44 0.45
45 0.34
46 0.31
47 0.25
48 0.2
49 0.19
50 0.2
51 0.21
52 0.25
53 0.31
54 0.31
55 0.39
56 0.43
57 0.49
58 0.55
59 0.53
60 0.52
61 0.47
62 0.42
63 0.38
64 0.33
65 0.28
66 0.2
67 0.19
68 0.17
69 0.18
70 0.15
71 0.1
72 0.14
73 0.17
74 0.25
75 0.28
76 0.35
77 0.44
78 0.53
79 0.61
80 0.67
81 0.74
82 0.75
83 0.81
84 0.83
85 0.84
86 0.85
87 0.82
88 0.8
89 0.77
90 0.73
91 0.73
92 0.72
93 0.71
94 0.67
95 0.7
96 0.68
97 0.64
98 0.63
99 0.56
100 0.48
101 0.42
102 0.41
103 0.37
104 0.32
105 0.32
106 0.27