Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094AYI7

Protein Details
Accession A0A094AYI7    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-26PLPQQRAHSRRKRKEDAKRNTQTPNTHydrophilic
NLS Segment(s)
PositionSequence
9-15SRRKRKE
Subcellular Location(s) mito 16, nucl 8, cyto 3
Family & Domain DBs
Amino Acid Sequences PLPQQRAHSRRKRKEDAKRNTQTPNTLHLVASQTIGASPDEVIHFAHIGAYGREEGFCAAAVLGERGAVEVGEGFADCDGDDDDGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.92
4 0.92
5 0.9
6 0.85
7 0.82
8 0.76
9 0.71
10 0.62
11 0.57
12 0.5
13 0.42
14 0.36
15 0.3
16 0.29
17 0.23
18 0.21
19 0.15
20 0.1
21 0.09
22 0.1
23 0.08
24 0.06
25 0.05
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.05
33 0.05
34 0.05
35 0.06
36 0.05
37 0.06
38 0.06
39 0.07
40 0.07
41 0.07
42 0.06
43 0.06
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.06
66 0.06