Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094AK07

Protein Details
Accession A0A094AK07    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
76-97QKTMTEKKPTSKKSTQKKPKTKHydrophilic
NLS Segment(s)
PositionSequence
82-97KKPTSKKSTQKKPKTK
Subcellular Location(s) nucl 18, mito_nucl 12.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MSSQQQNSVNSGRNVPSSAGPSTGFSLDTLSTAPLGPTYNPFAEWESNTSRRDNPITDFLFDCTAVDEPTQKESGQKTMTEKKPTSKKSTQKKPKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.26
4 0.24
5 0.23
6 0.21
7 0.19
8 0.19
9 0.19
10 0.18
11 0.16
12 0.12
13 0.13
14 0.11
15 0.11
16 0.09
17 0.08
18 0.08
19 0.07
20 0.07
21 0.06
22 0.07
23 0.07
24 0.09
25 0.12
26 0.11
27 0.12
28 0.13
29 0.14
30 0.15
31 0.15
32 0.16
33 0.18
34 0.22
35 0.23
36 0.24
37 0.23
38 0.24
39 0.26
40 0.24
41 0.22
42 0.25
43 0.25
44 0.25
45 0.24
46 0.23
47 0.21
48 0.2
49 0.17
50 0.11
51 0.1
52 0.09
53 0.09
54 0.1
55 0.11
56 0.14
57 0.15
58 0.14
59 0.17
60 0.19
61 0.25
62 0.25
63 0.26
64 0.31
65 0.4
66 0.47
67 0.52
68 0.53
69 0.57
70 0.64
71 0.69
72 0.71
73 0.71
74 0.74
75 0.76
76 0.84
77 0.86