Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094AY07

Protein Details
Accession A0A094AY07    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-37RSTVSHMFRNKQRRRPYHRPYRAVNEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MADHGTPSHSGRSTVSHMFRNKQRRRPYHRPYRAVNEAAINARIRREVEEELRKEKVAAAAQKELLEKKEEFKLRFSEINKKGADNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.37
4 0.4
5 0.46
6 0.53
7 0.6
8 0.64
9 0.66
10 0.73
11 0.76
12 0.82
13 0.86
14 0.88
15 0.88
16 0.89
17 0.86
18 0.82
19 0.79
20 0.75
21 0.66
22 0.56
23 0.46
24 0.37
25 0.32
26 0.27
27 0.2
28 0.14
29 0.13
30 0.13
31 0.11
32 0.12
33 0.14
34 0.15
35 0.21
36 0.29
37 0.31
38 0.34
39 0.35
40 0.33
41 0.3
42 0.28
43 0.25
44 0.22
45 0.24
46 0.24
47 0.26
48 0.27
49 0.28
50 0.29
51 0.27
52 0.24
53 0.23
54 0.21
55 0.21
56 0.29
57 0.34
58 0.33
59 0.36
60 0.39
61 0.4
62 0.45
63 0.46
64 0.49
65 0.47
66 0.53
67 0.5