Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094APE1

Protein Details
Accession A0A094APE1   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
361-383EAGPSKPAPKKVKRKAEEEAEKEBasic
NLS Segment(s)
PositionSequence
194-219RSRRSVSPSKIASPLKKTIATPRKLK
266-279PKRKSKAAKAEVAK
364-404PSKPAPKKVKRKAEEEAEKEDEGQAPAKRAKMESDLKKEKV
Subcellular Location(s) nucl 9.5, cyto_nucl 8.833, cyto_mito 7.333, cyto 7, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037548  Bqt4  
IPR036887  HTH_APSES_sf  
IPR018004  KilA/APSES_HTH  
IPR003163  Tscrpt_reg_HTH_APSES-type  
Gene Ontology GO:1990862  C:nuclear membrane complex Bqt3-Bqt4  
GO:0003677  F:DNA binding  
GO:0048315  P:conidium formation  
GO:0070197  P:meiotic attachment of telomere to nuclear envelope  
GO:0030435  P:sporulation resulting in formation of a cellular spore  
PROSITE View protein in PROSITE  
PS51299  HTH_APSES  
Amino Acid Sequences MSSARHLPEKRNALLMVENAPKYESLVERRRLGQTDLQVKAKQHGTFDYAHLRAPLPKNVVSGIFKPAPASYFLMRRSNDGYISATGMFKATFPYAEVVEEEAERNYVKSLPTTSPNETAGNVWISPTHALELADEYGIRVWIKALLDPTPIVVNPKGDTTPKKISPPPTFLLAPEDLAAPTDSTGRSGEALRRSRRSVSPSKIASPLKKTIATPRKLKQKAAAEESASASSKNLQQALKSATKPEASPSSSSVAEKEDATASPEPKRKSKAAKAEVAKAGATKADAEKEKDPKVTVQVDKEVVVEGDVETTHTHVEVEMPAGFAELPLPEDTEAMIAKAKEMVDAAVKADEAAKDAAEAEAGPSKPAPKKVKRKAEEEAEKEDEGQAPAKRAKMESDLKKEKVRARALIGISATLAIGALIPYVMGAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.4
3 0.37
4 0.35
5 0.33
6 0.28
7 0.29
8 0.26
9 0.24
10 0.26
11 0.24
12 0.27
13 0.36
14 0.42
15 0.46
16 0.5
17 0.54
18 0.53
19 0.52
20 0.49
21 0.49
22 0.52
23 0.53
24 0.54
25 0.52
26 0.5
27 0.51
28 0.51
29 0.44
30 0.38
31 0.36
32 0.34
33 0.33
34 0.36
35 0.38
36 0.32
37 0.32
38 0.31
39 0.29
40 0.33
41 0.35
42 0.38
43 0.34
44 0.35
45 0.35
46 0.35
47 0.38
48 0.34
49 0.32
50 0.32
51 0.29
52 0.27
53 0.27
54 0.26
55 0.23
56 0.22
57 0.24
58 0.2
59 0.24
60 0.29
61 0.35
62 0.34
63 0.37
64 0.38
65 0.36
66 0.34
67 0.3
68 0.28
69 0.22
70 0.23
71 0.21
72 0.17
73 0.14
74 0.14
75 0.12
76 0.09
77 0.11
78 0.1
79 0.09
80 0.1
81 0.11
82 0.11
83 0.12
84 0.12
85 0.11
86 0.11
87 0.12
88 0.11
89 0.1
90 0.1
91 0.1
92 0.09
93 0.09
94 0.1
95 0.1
96 0.12
97 0.15
98 0.18
99 0.24
100 0.28
101 0.31
102 0.32
103 0.34
104 0.33
105 0.29
106 0.27
107 0.23
108 0.19
109 0.16
110 0.13
111 0.11
112 0.11
113 0.11
114 0.11
115 0.09
116 0.09
117 0.09
118 0.09
119 0.11
120 0.1
121 0.09
122 0.09
123 0.08
124 0.07
125 0.08
126 0.08
127 0.06
128 0.05
129 0.08
130 0.09
131 0.1
132 0.11
133 0.11
134 0.13
135 0.13
136 0.13
137 0.11
138 0.11
139 0.12
140 0.12
141 0.12
142 0.12
143 0.13
144 0.14
145 0.17
146 0.21
147 0.25
148 0.31
149 0.33
150 0.38
151 0.41
152 0.48
153 0.5
154 0.53
155 0.47
156 0.44
157 0.41
158 0.36
159 0.35
160 0.27
161 0.21
162 0.16
163 0.14
164 0.1
165 0.11
166 0.1
167 0.06
168 0.06
169 0.07
170 0.06
171 0.07
172 0.08
173 0.07
174 0.08
175 0.09
176 0.13
177 0.2
178 0.27
179 0.31
180 0.34
181 0.36
182 0.39
183 0.42
184 0.45
185 0.46
186 0.44
187 0.47
188 0.45
189 0.46
190 0.49
191 0.48
192 0.45
193 0.41
194 0.4
195 0.35
196 0.34
197 0.32
198 0.36
199 0.42
200 0.43
201 0.45
202 0.47
203 0.55
204 0.56
205 0.57
206 0.54
207 0.54
208 0.54
209 0.52
210 0.48
211 0.38
212 0.37
213 0.36
214 0.3
215 0.22
216 0.16
217 0.11
218 0.11
219 0.12
220 0.13
221 0.15
222 0.14
223 0.15
224 0.18
225 0.23
226 0.26
227 0.24
228 0.24
229 0.23
230 0.24
231 0.24
232 0.23
233 0.23
234 0.2
235 0.21
236 0.21
237 0.21
238 0.21
239 0.21
240 0.19
241 0.16
242 0.15
243 0.13
244 0.12
245 0.11
246 0.1
247 0.14
248 0.16
249 0.16
250 0.21
251 0.27
252 0.29
253 0.33
254 0.38
255 0.4
256 0.46
257 0.53
258 0.57
259 0.59
260 0.64
261 0.62
262 0.65
263 0.61
264 0.53
265 0.44
266 0.34
267 0.27
268 0.19
269 0.16
270 0.1
271 0.09
272 0.13
273 0.15
274 0.19
275 0.24
276 0.3
277 0.33
278 0.33
279 0.33
280 0.3
281 0.35
282 0.38
283 0.36
284 0.34
285 0.34
286 0.33
287 0.33
288 0.31
289 0.25
290 0.18
291 0.14
292 0.11
293 0.07
294 0.06
295 0.06
296 0.06
297 0.06
298 0.07
299 0.07
300 0.06
301 0.06
302 0.06
303 0.07
304 0.07
305 0.08
306 0.08
307 0.08
308 0.08
309 0.08
310 0.08
311 0.07
312 0.07
313 0.05
314 0.07
315 0.07
316 0.08
317 0.08
318 0.08
319 0.08
320 0.09
321 0.09
322 0.07
323 0.1
324 0.09
325 0.09
326 0.12
327 0.11
328 0.11
329 0.11
330 0.11
331 0.12
332 0.12
333 0.13
334 0.11
335 0.11
336 0.1
337 0.12
338 0.11
339 0.1
340 0.1
341 0.09
342 0.09
343 0.1
344 0.09
345 0.08
346 0.07
347 0.07
348 0.12
349 0.12
350 0.13
351 0.14
352 0.2
353 0.25
354 0.34
355 0.43
356 0.48
357 0.59
358 0.69
359 0.79
360 0.79
361 0.82
362 0.81
363 0.82
364 0.82
365 0.76
366 0.73
367 0.67
368 0.61
369 0.54
370 0.47
371 0.38
372 0.3
373 0.29
374 0.23
375 0.25
376 0.28
377 0.3
378 0.31
379 0.31
380 0.33
381 0.37
382 0.45
383 0.49
384 0.56
385 0.62
386 0.64
387 0.69
388 0.73
389 0.71
390 0.71
391 0.68
392 0.63
393 0.6
394 0.63
395 0.57
396 0.55
397 0.48
398 0.39
399 0.31
400 0.26
401 0.2
402 0.12
403 0.1
404 0.05
405 0.05
406 0.04
407 0.04
408 0.04
409 0.03